|
|
||||||||
|
American Society of Plant Biologists Arabidopsis SON1 Is an F-Box Protein That Regulates a Novel Induced Defense Response Independent of Both Salicylic Acid and Systemic Acquired ResistanceCornell University, Department of Plant Pathology, 360 Plant Science Building, Ithaca, New York 14853 1 To whom correspondence should be addressed. E-mail tpd4{at}cornell.edu; fax 607-255-4471
One of several induced defense responses in plants is systemic acquired resistance (SAR), which is regulated by salicylic acid and in Arabidopsis by the NIM1/NPR1 protein. To identify additional components of the SAR pathway or other genes that regulate SAR-independent resistance, we performed genetic suppressor screens of mutagenized nim1-1 seedlings, which are highly susceptible to infection by Peronospora parasitica. We isolated the son1 (suppressor of nim1-1) mutant, which shows full restoration of pathogen resistance without the induction of SAR-associated genes and expresses resistance when combined with a salicylate hydroxylase (nahG) transgene. These features indicate that son1-mediated resistance is distinct from SAR. Resistance is effective against both the virulent oomycete Peronospora and the bacterial pathogen Pseudomonas syringae pv tomato strain DC3000. We cloned SON1 and found it to encode a novel protein containing an F-box motif, an element found within the specificity determinant in the E3 ubiquitin-ligase complex. We propose the existence of a novel defense response that is independent of SAR and negatively regulated in Arabidopsis by SON1 through the ubiquitin-proteosome pathway.
Plants use a number of pathogen-induced defense pathways to prevent or control disease, which together constitute the general or innate immune system. Identification of several key regulators of plant immunity has revealed a complex network of interacting defense pathways (Feys and Parker, 2000
The naturally occurring compound salicylic acid (SA) is a crucial signaling compound for the induction of SAR. Application to plants of SA or its functional analog 2,6-dichloroisonicotinic acid (INA) effectively induces SAR (Kessmann et al., 1994
Exogenous application of SA or INA to plants triggers the onset of disease resistance coincident with the induction of a large number of defense response genes, including many pathogenesis-related (PR) genes, which are used commonly as molecular markers to monitor SAR activation (Ward et al., 1991
Using SA or its functional analogs, several groups performed mutant screens to identify additional components in the SAR pathway. Two of these groups used transgenic plants that harbored PR gene promoterreporter fusions and isolated mutants unable to induce the reporter after treatment with INA or SA (Cao et al., 1994
Despite these differences in design, the approximately 11 mutants isolated in these screens were allelic, having mutations in the same gene called NIM1/NPR1/SAI1 (Cao et al., 1994
In addition to regulating SAR, NIM1 has been shown to be required for the activation of a SAR-independent defense pathway called induced systemic resistance (ISR) (Pieterse et al., 1996
To reveal additional regulators of the plant immune response associated with NIM1, we screened for genetic suppressor mutations that ameliorate the highly pathogen-susceptible nim1-1 mutant phenotype. We screened for plants resistant to a highly virulent strain of Peronospora parasitica, which gave us access to a range of types of mutations that could produce resistance in a nim1-1 mutant background. We identified five son (suppressor of nim1-1) mutants based on their pathogen-resistant phenotype. One of these, son1, exhibited heightened resistance without the attendant induction of SAR-associated PR genes or PDF1.2, a marker for a jasmonic aciddependent inducible defense response (Epple et al., 1997
Because son1 mutants exhibit resistance in a nim1-1 background, do not accumulate PR or PDF1.2 gene transcripts, and are resistant independent of SA accumulation, pathogen resistance in son1 plants is unlike other previously characterized defense mechanisms. The son1 mutation is recessive, indicating that SON1 negatively regulates a novel SAR- and NIM1-independent defense response. Cloning of SON1 revealed that it encodes a novel protein containing an F-box, an element found within the specificity-determining component of the E3 ubiquitin-ligase complex (Bai et al., 1996
nim1-1 Suppressor Mutant Screen and Genetic Analysis of son1 Homozygous Wassilewskija (Ws) nim1-1 kanamycin-resistant seeds were mutagenized using ethyl methanesulfonate and grown to mature plants, which were harvested to yield M2 seeds. Two-week-old M2 seedlings were screened for resistance against the highly virulent Peronospora isolate Emwa1. Approximately 95,000 M2 plants were screened to identify individuals that exhibited resistance to Peronospora infection, and five son mutants (son1 to son5) were isolated. M3 seeds derived from each son mutant were grown on agar medium containing kanamycin to verify that the drug resistance trait was fixed, ensuring that the mutants were not false positives resulting from contamination with wild-type seeds or pollen (data not shown).
The son1 mutant showed a high level of resistance to Peronospora, with little evidence of downy mildew disease or hyphal development (Figure 1A)
. Quantification of conidiophore production showed that son1 plants had one-quarter the number of these reproductive structures compared with nim1-1, and
Resistance of son1 to Pseudomonas syringae pv tomato To determine whether disease resistance in son1 plants also was effective against a pathogen distinct from Peronospora, son1 mutants were infected with the virulent bacterial pathogen Pseudomonas syringae pv tomato strain DC3000 (Pst DC3000). Three days after infection, son1 mutants displayed less chlorosis and fewer disease symptoms than either wild-type or nim1-1 plants (Figure 1C). Bacterial growth also was restricted in son1 mutants compared with wild-type and nim1-1 plants (Figure 1D), indicating that son1-mediated resistance was active against Pst DC3000.
Genetic Analysis of the son1 Mutant To determine whether son1-mediated resistance was influenced by the presence of specific nim1 alleles, son1 nim1-1 plants were crossed to nim1-2 and nim1-4 plants. Allele-specific PCR was used to identify F2 seedlings homozygous for each of the introgressed nim1 alleles, and at least five such lines advanced to produce F3 seeds. Because each F2 plant had a 75% probability of carrying at least one copy of the son1 mutation, we were confident that, by analyzing five F3 populations, at least one would segregate son1 homozygous F3 progeny. In both the nim1-2 and nim1-4 homozygous F3 lines, we found resistant son1 nim1-2 and son1 nim1-4 plants, showing that son1-mediated resistance is not allele specific, because it was expressed in the presence of two other nim1 alleles (data not shown).
To determine whether son1-mediated resistance is dependent on SA accumulation, son1 nim1-1 plants were crossed to NahG transgenic plants. F2 son1 nim1-1 NahG homozygous lines were identified using PCR-based markers and the hygromycin marker linked to the NahG transgene. Mutant allelespecific primers were used to identify nim1-1 homozygotes (Lo et al., 1992
Molecular Phenotype of son1 Plants To determine whether resistance in son1 plants was accompanied by expression of PR or jasmonate-responsive genes, leaves from wild-type (Ws-0), nim1, son1 nim1, and son1 NIM1 plants were collected before and 3, 5, and 7 days after Peronospora Emwa1 inoculation and used for RNA extraction. RNA gel blots were probed with radiolabeled cDNA probes corresponding to the Arabidopsis PR-1, PR-2, PR-5, and PDF1.2 genes (Figure 3) . The amount of PR-1 mRNA accumulation in the son1 nim1-1 double mutant after Peronospora infection was significantly less than the levels seen in wild type Ws-0 and slightly less than or equal to the amount observed in nim1-1. Similarly, PR-2 and PR-5 levels were reduced in son1 relative to nim1-1 and wild-type plants.
These data indicate that resistance in son1 nim1-1 plants is not linked to the induction of SAR genes. Because son1 mutants display heightened resistance to Peronospora infection but do not show induction of PR gene expression, we tested whether the expression of the jasmonic acidresponsive defensin gene PDF1.2 was increased in son1 nim1-1 plants after inoculation with Peronospora. We detected no increase in PDF1.2 expression in son1 nim1-1 mutants after this treatment (Figure 3). Examination of the molecular phenotype of son1 plants that contain a functional NIM1 gene revealed an interesting constitutive increase in PR-1, PR-2, and PR-5 expression but not in PDF1.2 expression (Figure 3). This finding suggests that the son1 mutation activates both a SAR-independent defense response in nim1-1 mutants and SAR in NIM1 plants. We also examined the accumulation of PR gene mRNAs after treatment with INA, an analog of SA. Wild-type plants showed the expected strong PR gene induction response to this treatment, whereas nim1-1 plants showed a much reduced response, and son1 nim1-1 plants were even less responsive than nim1-1 (Figure 4) .
Map-Based Cloning of SON1 The son1 mutant was isolated in a screen of Ws nim1-1 plants. Therefore, to map the SON1 gene, we performed crosses between son1-1 nim1-1 and Columbia (Col) npr1-2 plants. The son1 mutant phenotype was identified in F2 plants by their resistance to the Peronospora isolate Emco5, which is virulent in both Ws-0 and Col-0 accessions. The npr1-2 allele was included in the cross to reduce the possibility that the segregation of nim1-1 would complicate the identification of son1 F2 progeny.
The F2 mapping population was phenotyped for Emco5 resistance on 2-week-old plants, and resistant individuals were examined for segregation of PCR-based molecular markers. For the initial mapping, 48 F2 plants resistant to Emco5 infection were tested with codominant cleaved amplified polymorphic sequence (CAPS) markers from each of the five chromosomes (Konieczny and Ausubel, 1993
Further analysis of this region showed the son1 mutation to be localized between THY1 and PHYB markers, which are
To confirm that ORF4 corresponded to the SON1 gene, Agrobacterium tumefaciensmediated transformation was used to introduce into son1 plants a cDNA that corresponds to ORF4 under the control of the 35S promoter of Cauliflower mosaic virus. Thirty-three primary transgenic lines were obtained and found to have lost resistance to Peronospora isolate Emwa1 and Pst DC3000, indicating that ORF4 is equivalent to SON1 (Figure 6) .
Analysis of SON1 Structure The SON1 gene has an uninterrupted ORF of 1113 bp, which encodes a novel 370amino acid protein (Figure 7A) . The N-terminal region of SON1 contains an F-box domain, which is a conserved 40 to 50amino acid motif found within F-box proteins that are part of the E3 ubiquitin-ligase complex and are involved in recognition of both the E2 and substrate for ubiquitination (Bai et al., 1996
However, the son1-1 mutation occurs in the carboxyl third of the protein, a G-to-A transition that results in an Arg-to-Gln substitution at amino acid 257, suggesting that this region is important to SON1 function (Figure 7A). Although SON1 is unlike other described proteins, its F-box region is highly similar to those of other F-box proteins from Arabidopsis, yeast, and human (Figure 7B), suggesting that SON1 also functions in conjunction with the E3 ubiquitin-ligase complex. Analysis of SON1 using reverse position-specific BLAST (http://www.ncbi.nlm.nih.gov) indicates that the putative F-box in this protein is supported by an expected value of 1 e-06, as related to the conserved F-box domain Smart00256 (LPDEILEEILSKLPPKDLLRLRKVSRKWRSLIDSHDFWFKL).
Accumulation of SON1 mRNA in Wild-Type, nim1-1, and son1 nim1 Plants
In a screen to identify genetic suppressor mutations of the nim1-1 mutation and thereby reveal regulators of disease resistance, we isolated son1, a mutant that shows robust resistance to infection by both an oomycete and a bacterial pathogen and that appears to express a novel form of defense response. Resistance mediated by the recessive son1 mutation is not attributable to SAR, because son1 nim1-1 double mutants did not show significant accumulation of PR gene transcripts after pathogen exposure or in response to INA treatment, as would occur in wild-type plants or in nim1-1 plants carrying suppressors that restore function to the NIM1 pathway. Furthermore, SA accumulation is not required for the expression of son1-mediated resistance, because son1 nim1-1 NahG plants were as resistant to Peronospora and Pst DC3000 as son1 nim1 plants.
The jasmonic acidinduced defensin gene PDF1.2 also was not induced in son1 nim1-1 plants or in son1 plants, indicating that the mutation does not activate jasmonic acid signaling pathways. These unique characteristics distinguish son1 from other known nim1/npr1 suppressors, including sni1, ssi1, ssi2, cpr5, and cpr6. Plants carrying sni1 npr1-1 mutations show strong inducibility of PR genes after INA treatment (Li et al., 1999
In the presence or absence of NIM1, the cpr5 and cpr6 mutants also show constitutive expression of PR and PDF1.2 genes and may express both SAR and SAR-independent defense responses (Bowling et al., 1997 The constitutive expression of PR genes observed in son1 NIM1 plants was dependent on a functional NIM1, suggesting that in the absence of elicitation, SON1 acts to repress NIM1-dependent PR gene expression. Furthermore, the expression in son1 nim1-1 plants of SA- and PR geneindependent resistance indicates that SON1 acts as a negative regulator of a SAR-independent resistance (SIR) mechanism. Therefore, SON1 appears to have a dual role in repressing both SAR and SIR systems. Because constitutive expression of PR genes is not observed in son1 nim1-1 plants with respect to SAR, nim1 is epistatic to son1, indicating that the influence of SON1 on the SAR pathway occurs upstream of NIM1 or at NIM1 directly.
The dual role postulated for SON1 in SAR and SIR may be accomplished mechanistically by SON1 acting to repress the regulatory components required for both SAR and SIR or a regulator common to both defense systems. Alternatively, the pathogen-resistant phenotype of son1 plants may be a secondary effect of the mutation rather than the result of a direct activation of a SON1-regulated defense pathway. Indirect activation of defenses has been observed in plant mutants with defects in chlorophyll biosynthesis or catabolism, and a variety of other metabolic perturbations have been implicated in the induction of plant defense (Delaney, 1997 To understand how SON1 may regulate two distinct defense response pathways, we cloned SON1 in a map-based approach using molecular markers and the published sequence of the Arabidopsis genome. SON1 is a 1.1-kb intronless gene that encodes a novel 370amino acid protein that contains an N-terminal F-box motif. SON1 is like approximately half of the known F-box proteins in that it lacks a recognizable C-terminal proteinprotein interaction domain. This region in SON1, though, is likely to be important to its function, because the son1-1 mutation causes a substitution in this part of the predicted protein.
Work with the yeast Saccharomyces cerevisiae has provided the greatest understanding of F-box protein function. In that species, these proteins have been shown to play a role as specificity factors in the SCF (Skp1, Cdc53/Cullin, F-box receptor) E3 ubiquitin-ligase complex that regulates the accumulation of specific cellular proteins through their polyubiquitination and proteolysis (Skowyra et al., 1997
The targeting specificity is conferred by the C-terminal end of the F-box protein, which often contains a recognizable proteinprotein interaction region in the form of Leu-rich, WD-40, or kelch repeats (Craig and Tyers, 1999
In Arabidopsis, SON1 is the seventh F-box protein revealed to have a known function, although
Yeast two-hybrid studies also have shown that TIR1, UFO, ORE9, and COI1 are able to interact with AtASK1, the Arabidopsis homolog of the yeast SKP1 component of the SCF complex, supporting the involvement of ubiquitination-dependent proteolysis as an essential regulatory mechanism in plant signal transduction pathways (del Pozo and Estelle, 1999 We suggest that SON1 functions as a component of an SCF ubiquitin ligase complex and interacts specifically with one or more substrate proteins, thus controlling their stability through ubiquitination. Therefore, learning the identity of the target substrate for SON1 is of great interest, because it is likely to act as a positive regulator of both the SAR and SIR pathways. This assumption is based on the induction of these defense responses in son1 plants and on the presumed role of SON1 in promoting the degradation of its substrate. Based on the recognition that SON1 is an F-box protein, a possible mechanism for how the son1 mutation activates two distinct defense responses is that SON1 targets for degradation different positive regulators of SAR and SIR or a single factor common to both pathways. Thus, in son1 plants, the SON1 substrate(s) accumulates, activating SIR in nim1-1 as well as SAR in NIM1 plants. Candidates for such a regulatory factor would be proteins that displace negative transcriptional regulators of PR genes and genes whose expression may be associated with son1-mediated SIR. Alternatively, if NIM1 also regulates the SIR mechanism activated in son1 plants, as it does in SAR, the target of SON1 may be NIM1 itself.
The mechanism by which SON1 activity is regulated is unknown, but regulation of F-box proteins may occur at a number of levels. Although we found no evidence for pathogen- or INA-induced changes in SON1 mRNA accumulation, transcriptional and post-transcriptional regulation of F-box proteins has been observed in a few cases (Kornitzer and Ciechanover, 2000 The isolation and characterization of the son1 mutant demonstrates the existence of an effective, broad-spectrum defense system independent from known defense responses that are mediated by SA or jasmonic acid accumulation. The phenotype of son1 plants indicates that SON1 acts as a negative regulator of this defense response and, unexpectedly, also acts to negatively regulate SAR from a position upstream of or at NIM1. Cloning of the SON1 gene showed that it encodes an F-box protein, suggesting that the gene product plays a role in the selective ubiquitination and degradation of one or more target proteins. Thus, the protein(s) targeted by SON1 may act as a positive regulator of SAR and SIR. Greater understanding of the mechanism of SON1 action, and elucidation of its targets, will contribute to the engineering of disease resistance in agricultural crop species.
Plants and Growth Conditions Arabidopsis thaliana accession Wassilewskija (Ws-0) was obtained from the ABRC (Ohio State University, Columbus). Ws nim1-1 plants were described previously (Delaney et al., 1995 150 µE provided by cool-white fluorescent lamps) at 60% RH on Cornell soil mix (Boodley and Sheldrake, 1977
Genetic Suppressor Screen
Pathogen Inoculations
Pseudomonas syringae pv tomato (Pst) strain DC3000 was grown on King's medium B (KB; King et al., 1954 Collected leaf tissue from each sample was placed in preweighed 1.5-mL microcentrifuge tubes containing 1 mL of MgCl2 plus 0.02% Silwet. The Eppendorf tubes were reweighed with sample before shaking at 250 rpm at 28°C for 1 h. Dilutions (10-1 to 10-6) of each sample then were made using 10 mM MgCl2 in 96-well microtiter plates. Using a 96-well pin stamp, the dilutions were plated onto KB plates and left to incubate at 30°C. Colonies were counted 48 h later to determine the number of colony-forming units per milligram of leaf tissue.
RNA Gel Blot Analysis
2,6-Dichloroisonicotinic Acid Treatment
Fixation of Leaf Samples
Map-Based Cloning of son1 The CAPS marker THY1 on chromosome 2 was found to cosegregate with the son1 resistant phenotype, with six recombination breakpoints found between these loci among the 48 F2 plants tested. Additional CAPS markers surrounding THY1 were tested, and the son1 mutation was localized between CAPS markers THY1 and PHYB, 4.4 centimorgan or 1.02 Mb apart. DNA from an additional 485 F2 Emco5-resistant plants was tested with the THY1 and PHYB markers, and 33 additional recombinations were found using THY1 and 41 others found with PHYB. To fine-map the location of SON1, single nucleotide polymorphism (SNP) markers were designed within the region flanked by THY1 and PHYB using the Cereon Genomics SNP database and sequence information from the Arabidopsis genome sequencing project (http://mips.gsf.de/proj/thal/db/index.html). Using two SNPs, 7127-10521SNP (forward primer, 5'-TCCTTTGACGTCTTTATGTG-3'; reverse primer, 5'-GCCTCCTGTTTACTAATGAT-3'; T/C polymorphism in Col-0 versus Ws-0) and 7584-5790SNP (forward primer, 5'-TAATTCCATGTGATGCTTGTG-3'; reverse primer, 5'-AGTTGATACAACTCTCATGAAC-3'; G/A polymorphism in Ws-0 versus Col-0), we were able to localize SON1 to a 98-kb region bounded by these markers. The PCR protocol used for 7127-10521SNP and 7584-5790SNP was as follows: 95°C for 2 min, 95°C for 1 min, and 50°C for 2 min (for 30 cycles) followed by 72°C for 10 min. The 150-bp PCR product amplified using the 7127-10521SNP primers then was digested with the Fnu4HI restriction enzyme, which cleaves genomics DNA (gDNA) from Ws-0 plants but not Col-0 plants. The enzyme used to cut the 101-bp PCR product amplified with the 7584-5790SNP primers was AluI, which has a site in Col-0 gDNA but not in Ws-0. Both forward primers (7127-10521SNP and 7584-5790SNP) encompass the polymorphism and the resulting presence or absence of the restriction enzyme site. Of the 39 recombinations isolated using THY1, 2 remained at 7127-10521SNP, and of the 41 recombinations isolated using PHYB, 3 remained at 7584-5790SNP. The interval between THY1 and PHYB was examined using four additional SNP markers found in the Cereon SNP database, and the closest two were used to fine-map SON1. With one, 2329-13467SNP, we were able to reduce the number of recombinations remaining to one at the left side of SON1, whereas using the 2329-54226SNP marker, the number of recombinations remaining was reduced to two on the right border of SON1. The narrower interval defined by the two markers encompassed 41 kb of genomic sequence and contained 10 open reading frames (ORFs). The 2329-54226SNP marker (forward primer, 5'-CCAATTCATTGTTTTTGAACC-3'; reverse primer, 5'-GATGGAGAGATCAACGAGC-3') reveals in the 152-bp amplicon an A/T polymorphism between Ws-0 and Col-0 that produces an MfeI site in the Ws-0 product that is absent in Col-0. The 2329-13467SNP marker (forward primer, 5'-TTTGCTCTAAGTTTCAACAG-3'; reverse primer, 5'-GCCGACGTACGTTAATCATTTG-3') exploits a length polymorphism that causes a 180-bp product to be produced from Ws-0, whereas the product from Col-0 is 150 bp. The PCR conditions for both markers were identical to those described above except that the annealing temperature for 2329-13467SNP was 55°C instead of 50°C. Each of the 10 ORFs flanked by markers around SON1 were examined by designing PCR primers to amplify each ORF from gDNA of the son1 mutant and Ws-0 wild-type plants. Comparisons between the sequences of each of the ORFs from son1 and wild-type plants revealed a single G-to-A base pair difference in ORF4 that produces an Arg-to-Gln substitution at amino acid 257 in the predicted protein sequence.
Complementation of son1 with the Wild-Type Gene At 2 weeks of age, all 33 lines were inoculated with Peronospora and incubated in Percival growth chambers as described above. All 33 lines were as susceptible to Peronospora infection as nim1-1 mutants and displayed increased sporulation compared with nontransformed son1 nim1 plants. Upon request, all novel materials described in this article will be made available in a timely manner for noncommercial research purposes. No restrictions or conditions will be placed on the use of any materials described in this article that would limit their use for noncommercial research purposes.
Accession Numbers
We thank Chang-Sik Oh and Erika Brutsaert for their assistance in mapping SON1. We appreciate Cristiana Argueso's careful reading of the manuscript. We gratefully recognize the support for this project and other work in the laboratory provided by the Cornell University Department of Plant Pathology and by grants to T.P.D. from the National Science Foundation CAREER program (Grant IBN-9722377) and the U.S. Department of Agriculture National Research Initiative Competitive Grants Program (Grant 9802134).
Article, publication date, and citation information can be found at www.plantcell.org/cgi/doi/10.1105/tpc.001867. Received January 23, 2002; accepted March 20, 2002.
Adams, J., Kelso, R., and Cooley, L. (2000). The kelch repeat superfamily of proteins: Propellers of cell function. Trends Cell Biol. 10, 1724.[CrossRef][ISI][Medline]
Alexander, D., Goodman, R.M., Gut-Rella, M., Glascock, C., Weymann, K., Friedrich, L., Maddox, D., Ahl Goy, P., Luntz, T., Ward, E., and Ryals, J. (1993). Increased tolerance to two oomycete pathogens in transgenic tobacco expressing pathogenesis-related protein 1a. Proc. Natl. Acad. Sci. USA 90, 73277331. Andrade, M.A., Gonzalez-Guzman, M., Serrano, R., and Rodriguez, P.L. (2001). A combination of the F-box motif and kelch repeats defines a large Arabidopsis family of F-box proteins. Plant Mol. Biol. 46, 603614.[CrossRef][ISI][Medline] Arabidopsis Genome Initiative. (2000). Analysis of the genome sequence of the flowering plant Arabidopsis thaliana. Nature 408, 796815.[CrossRef][Medline] Bai, C., Sen, P., Hofmann, K., Ma, L., Goebl, M., Harper, J.W., and Elledge, S.J. (1996). SKP1 connects cell cycle regulators to the ubiquitin proteolysis machinery through a novel motif, the F-box. Cell 86, 263274.[CrossRef][ISI][Medline] Boodley, J.W., and Sheldrake, R., Jr. (1977). Cornell peat-lite mixes for commercial plant growing. NY State Coll. Agric. Life Sci. Inf. Bull. 43, 18. Bowling, S.A., Clarke, J.D., Liu, Y., Klessig, D.F., and Dong, X. (1997). The cpr5 mutant of Arabidopsis expresses both NPR1-dependent and NPR1-independent resistance. Plant Cell 9, 15731584.[Abstract] Cao, H., Bowling, S.A., Gordon, A.S., and Dong, X. (1994). Characterization of an Arabidopsis mutant that is nonresponsive to inducers of systemic acquired resistance. Plant Cell 6, 15831592.[Abstract] Cao, H., Glazebrook, J., Clarke, J.D., Volko, S., and Dong, X. (1997). The Arabidopsis NPR1 gene that controls systemic acquired resistance encodes a novel protein containing ankyrin repeats. Cell 88, 5763.[CrossRef][ISI][Medline]
Clarke, J.D., Liu, Y., Klessig, D.F., and Dong, X. (1998). Uncoupling PR gene expression from NPR1 and bacterial resistance: Characterization of the dominant Arabidopsis cpr6-1 mutant. Plant Cell 10, 557569. Clough, S.J., and Bent, A.F. (1998). Floral dip: A simplified method for Agrobacterium-mediated transformation of Arabidopsis thaliana. Plant J. 16, 735743.[CrossRef][ISI][Medline] Craig, K.L., and Tyers, M. (1999). The F-box: A new motif for ubiquitin dependent proteolysis in cell cycle regulation and signal transduction. Prog. Biophys. Mol. Biol. 72, 299328.[CrossRef][ISI][Medline] Delaney, T.P. (1997). Genetic dissection of acquired resistance to disease. Plant Physiol. 106, 512.
Delaney, T.P., Friedrich, L., and Ryals, J.A. (1995). Arabidopsis signal transduction mutant defective in chemically and biologically induced disease resistance. Proc. Natl. Acad. Sci. USA 92, 66026606.
Delaney, T.P., Uknes, S., Vernooij, B., Friedrich, L., Weymann, K., Negrotto, D., Gaffney, T., Gut-Rella, M., Kessmann, H., Ward, E., and Ryals, J. (1994). A central role of salicylic acid in plant disease resistance. Science 266, 12471250. Dellaporta, S.L., Wood, J., and Hicks, J.B. (1983). A plant DNA minipreparation: Version II. Plant Mol. Biol. Rep. 1, 1921. del Pozo, J.C., and Estelle, M. (1999). Function of the ubiquitin-proteosome pathway in auxin response. Trends Plant Sci. 4, 107112.[CrossRef][ISI][Medline] Deshaies, R.J. (1999). SCF and Cullin/Ring H2-based ubiquitin ligases. Annu. Rev. Cell Dev. Biol. 15, 435467.[CrossRef][ISI][Medline] Donofrio, N.M., and Delaney, T.P. (2001). Abnormal callose response phenotype and hypersusceptibility to Peronospora parasitica in defense-compromised Arabidopsis nim1-1 and salicylate hydroxylase-expressing plants. Mol. Plant-Microbe Interact. 14, 439450.[ISI][Medline] Epple, P., Apel, K., and Bohlmann, H. (1997). ESTs reveal a multigene family for plant defensins in Arabidopsis thaliana. FEBS Lett. 400, 168172.[CrossRef][ISI][Medline] Feys, B.J., and Parker, J.E. (2000). Interplay of signaling pathways in plant disease resistance. Trends Genet. 16, 449455.[CrossRef][ISI][Medline] Gaffney, T., Friedrich, L., Vernooij, B., Negrotto, D., Nye, G., Uknes, S., Ward, E., Kessmann, H., and Ryals, J. (1993). Requirement of salicylic acid for the induction of systemic acquired resistance. Science 261, 754756. Glazebrook, J. (2001). Genes controlling expression of defense responses in Arabidopsis: 2001 status. Curr. Opin. Plant Biol. 4, 301308.[CrossRef][ISI][Medline] Glazebrook, J., Rogers, E.E., and Ausubel, F.M. (1996). Isolation of Arabidopsis mutants with enhanced disease susceptibility by direct screening. Genetics 143, 973982.[Abstract]
Gray, W.M., del Pozo, J.C., Walker, L., Hobbie, L., Risseeuw, E., Banks, T., Crosby, W.L., Yang, M., Ma, H., and Estelle, M. (1999). Identification of an SCF ubiquitin-ligase complex required for auxin response in Arabidopsis thaliana. Genes Dev. 13, 16781691. Holub, E.B., Beynon, L.J., and Crute, I.R. (1994). Phenotypic and genotypic characterization of interactions between isolates of Peronospora parasitica and accessions of Arabidopsis thaliana. Mol. Plant-Microbe Interact. 7, 223239.[ISI]
Kaiser, P., Sia, R.A., Bardes, E.G., Lew, D.J., and Reed, S.I. (1998). Cdc34 and the F-box protein Met30 are required for degradation of the Cdk-inhibitory kinase Swe1. Genes Dev. 12, 25872597. Kessmann, H., Staub, T., Hofmann, C., Maetzke, T., Herzog, J., Ward, E., Uknes, S., and Ryals, J. (1994). Induction of systemic acquired resistance in plants by chemicals. Annu. Rev. Phytopathol. 32, 439459.[CrossRef][ISI] King, E.O., Ward, M.K., and Raney, D.E. (1954). Two simple media for the demonstration of pyocyanin and fluorescin. J. Lab. Clin. Med. 44, 301307.[Medline] Kipreos, E.T., and Pagano, M. (2000). The F-box protein family. Genome Biol. 1, 3002.13002.7. Knoester, M., Pieterse, C.M., Bol, J.F., and Van Loon, L.C. (1999). Systemic resistance in Arabidopsis induced by rhizobacteria requires ethylene-dependent signaling at the site of application. Mol. Plant-Microbe Interact. 12, 720727.[ISI][Medline] Kobe, B., and Kajava, A.V. (2001). The leucine-rich repeat as a protein recognition motif. Curr. Opin. Struct. Biol. 11, 725732.[CrossRef][ISI][Medline] Koncz, C., Chua, N.-H., and Schell, J. (1992). Methods in Arabidopsis Research. (London: World Scientific Publishing). Konieczny, A., and Ausubel, F.M. (1993). A procedure for mapping Arabidopsis mutations using co-dominant ecotype-specific PCR-based markers. Plant J. 4, 403410.[CrossRef][ISI][Medline] Kornitzer, D., and Ciechanover, A. (2000). Modes of regulation of ubiquitin-mediated protein degradation. J. Cell Physiol. 182, 111.[CrossRef][ISI][Medline] Li, X., Zhang, Y., Clarke, J.D., Li, Y., and Dong, X. (1999). Identification and cloning of a negative regulator of systemic acquired resistance, SNI1, through a screen for suppressors of npr1-1. Cell 98, 329339.[CrossRef][ISI][Medline]
Lo, E.S., Lo, Y.M., Tse, C.H., and Fleming, K.A. (1992). Detection of hepatitis B pre-core mutant by allele specific polymerase chain reaction. J. Clin. Pathol. 45, 689692. Manners, J.M., Penninckx, I.A., Vermaere, K., Kazan, K., Brown, R.L., Morgan, A., Maclean, D.J., Curtis, M.D., Cammue, B.P., and Broekaert, W.F. (1998). The promoter of the plant defensin gene PDF1.2 from Arabidopsis is systemically activated by fungal pathogens and responds to methyl jasmonate but not to salicylic acid. Plant Mol. Biol. 38, 10711080.[CrossRef][ISI][Medline]
Molina, A., Hunt, M.D., and Ryals, J.A. (1998). Impaired fungicide activity in plants blocked in disease resistance signal transduction. Plant Cell 10, 19031914. Murashige, T., and Skoog, F. (1962). A revised medium for rapid growth and bioassays with tobacco tissue culture. Physiol. Plant. 15, 473497.[CrossRef] Neer, E.J., Schmidt, C.J., Nambudripad, R., and Smith, T.F. (1994). The ancient regulatory-protein family of WD-repeat proteins. Nature 371, 297300.[CrossRef][Medline] Neff, M.M., Neff, J.D., Chory, J., and Pepper, A.E. (1998). dCAPS, a simple technique for the genetic analysis of single nucleotide polymorphisms: Experimental applications in Arabidopsis thaliana genetics. Plant J. 14, 387392.[CrossRef][ISI][Medline] Nelson, D.C., Lasswell, J., Rogg, L.E., Cohen, M.A., and Bartel, B. (2000). FKF1, a clock-controlled gene that regulates the transition to flowering in Arabidopsis. Cell 101, 331340.[CrossRef][ISI][Medline] Patton, E.E., Willems, A.R., and Tyers, M. (1998). Combinatorial control in ubiquitin-dependent proteolysis: Don't Skp the F-box hypothesis. Trends Genet. 14, 236243.[CrossRef][ISI][Medline] Pieterse, C.M., van Wees, S.C., Hoffland, E., van Pelt, J.A., and van Loon, L.C. (1996). Systemic resistance in Arabidopsis induced by biocontrol bacteria is independent of salicylic acid accumulation and pathogenesis-related gene expression. Plant Cell 8, 12251237.[Abstract]
Pieterse, C.M., van Wees, S.C., van Pelt, J.A., Knoester, M., Laan, R., Gerrits, H., Weisbeek, P.J., and van Loon, L.C. (1998). A novel signaling pathway controlling induced systemic resistance in Arabidopsis. Plant Cell 10, 15711580. Pieterse, C.M.J., Van Pelt, J.A., Ton, J., Parchmann, S., Mueller, M.J., Buchala, A.J., Metraux, J.P., and Van Loon, L.C. (2000). Rhizobacteria-mediated induced systemic resistance (ISR) in Arabidopsis requires sensitivity to jasmonate and ethylene but is not accompanied by an increase in their production. Physiol. Mol. Plant Pathol. 57, 123134.[CrossRef]
Ruegger, M., Dewey, E., Gray, W.M., Hobbie, L., Turner, J., and Estelle, M. (1998). The TIR1 protein of Arabidopsis functions in auxin response and is related to human SKP2 and yeast Grr1p. Genes Dev. 12, 198207. Ryals, J., Neuenschwander, U.H., Willits, M.G., Molina, A., Steiner, H.-Y., and Hunt, M.D. (1996). Systemic acquired resistance. Plant Cell 8, 18091819.[CrossRef][ISI][Medline]
Ryals, J., Weymann, K., Lawton, K.A., Friedrich, L., Ellis, D., Steiner, H.-Y., Johnson, J., Delaney, T.P., Jesse, T., Vos, P., and Uknes, S. (1997). The Arabidopsis NIM1 protein shows homology to the mammalian transcription factor inhibitor I Samach, A., Klenz, J.E., Kohalmi, S.E., Risseeuw, E., Haughn, G.W., and Crosby, W.L. (1999). The UNUSUAL FLORAL ORGANS gene of Arabidopsis thaliana is an F-box protein required for normal patterning and growth in the floral meristem. Plant J. 20, 433445.[CrossRef][ISI][Medline]
Shah, J., Kachroo, P., and Klessig, D.F. (1999). The Arabidopsis ssi1 mutation restores pathogenesis-related gene expression in npr1 plants and renders defensin gene expression salicylic acid dependent. Plant Cell 11, 191206. Shah, J., Kachroo, P., Nandi, A., and Klessig, D.F. (2001). A recessive mutation in the Arabidopsis SSI2 gene confers SA- and NPR1-independent expression of PR genes and resistance against bacterial and oomycete pathogens. Plant J. 25, 563574.[CrossRef][ISI] |