#NEXUS [!Imported PHYLIP file "14_short.dat" (Thursday, December 6, 2001 10:56 AM)] Begin data; Dimensions ntax=14 nchar=8856; Format datatype=protein gap=- missing=? matchchar=. interleave; Matrix Arabidopsi MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAA Nicotiana MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAA Oryza MTAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAA Pinus MTAIIERRESANLWSRFCDWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAA Marchantia MTATLERRESASIWGRFCDWVTSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAA Nephroselm MTAILERRESTSVWARFCDWVTSTENRLYIGWFGVLMIPLLLTATSVFIIGFIAAPPVDIDGIREPVSGSLLFGNNIISGAIIPSSAAIGIHFYPIWEAA Chlorella MTAILERRESASLWARFCEWVTSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSNAIGLHFYPIWEAA Chlamydomo MTAILERRENSSLWARFCEWITSTENRLYIGWFGVIMIPCLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVIPTSNAIGLHFYPIWEAA Mesostigma MTATLERRESANLWGRFCEFITSTENRLYIGWFGVIMIPCLLTAISVYIIAFVAAPPVDIDGIREPVSGSLLYGNNIISGSVIPMSNAIGLHFYPIWEAA Cyanophora MTATLERNASVSLWEQFCGFITSTENRLYIGWFGVLMFPLLLTATTLFIIAFVAAPPVDIDGIREPVAGSLFYGNNIISGAVIPSSAAIGMHFYPIWEAA Cyanidium MTVTLERRESTSLWERFCSWITSTENRLYIGWFGVLMIPCLLTATTVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPTSNAIGLHLYPIWEAA Odontella MTATLERREGVSLWERFCAWITSTENRLYIGWFGCLMFPTLLTATSCYIIAFIAAPPVDIDGIREPVAGSLLYGNNIISGAVIPSSNAIGMHFYPIWEAA Guillardia MTATLERRESASLWERFCSWITSTENRLYIGWFGVLMIPTLLTATTVFIIAFIAAPPVDIDGIREPVAGSLLYGNNIITGAVIPSSASIGIHFYPIWEAA Porphyra MTATLQRRESASLWERFCSWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFVAAPPVDIDGIREPVAGSLLYGNNIISGAVIPSSAAIGIHFYPIWEAA Arabidopsi SVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHML Nicotiana SVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHML Oryza SVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHML Pinus SVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHML Marchantia SVDEWLYNGGPYELIVLHFLLGVACYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHML Nephroselm SIDEWLYNGGCYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHML Chlorella SLDEWLYNGGPYQLIVCHFFLGICSYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFIIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHML Chlamydomo SLDEWLYNGGPYQLIVCHFLLGVYCYMGREWELSFRLGMRPWIAVAYSAPVAAASAVFLVYPIGQGSFSDGMPLGFSGTFNFMIVFQAEHNILMHPFHML Mesostigma SLDEWLYNGGPYLMVVCHFLLGIACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHML Cyanophora SLDEWLYNGGPYQFVVMHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHMM Cyanidium SLDEWLYNGGPYQLVVLHFLLGVAAYMGREWELSYRLGMRPWICVAFSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHMA Odontella SIDEWLYNGGPYQLIVLHFLLGVASYMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLVYPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHMA Guillardia SLDEWLYNGGPYQLIVDHFLLGVCGWIGREWEFSYRLGMRPWISVAFTAPVAAASAVFLVYPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHQL Porphyra SLDEWLYNGGPYQLVVLHFLTGVACYIGREWELSYRLGMRPWISVAFTAPVAAAAAVFLVYPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHQL Arabidopsi GVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF Nicotiana GVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF Oryza GVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF Pinus GVAGVFGGSLFSAMHGSLVTSSLIRETTENQSANAGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVAGIWFTALGISTMAFNLNGF Marchantia GVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF Nephroselm GVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVCIWFTALGVSTMAFNLNGF Chlorella GVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF Chlamydomo GVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGLSTMAFNLNGF Mesostigma GVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAVWPVVGIWFTAMGISTMAFNLNGF Cyanophora GVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLALWPVVGIWFTALGLSTMAFNLNGL Cyanidium GVAGVFGGALFSAMHGSLVTSSLIRETTENESPNYGYKLGQEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLGLWPVVGIWLTSIGISTMAFNLNGL Odontella GVAGVFGGSLFSAMHGSLVTSSLIRETTENESTNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLAAWPVVGIWLTAMGVSTMAFNLNGF Guillardia GVAGVFGGSLFSAMHGSLVTSSLIRETTENESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLGLWPVVGIWFTALGIMTMAFNLNGF Porphyra GVAGVFGGSLFSAMHGSLVTSSLIRETSENESANYAYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGLWPVVGIWLTALSVSTMAFNLNGF Arabidopsi NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVEAPSTNGFLVAKLPEAYAFLNPIVDVMPVIPLFFLLLAFVWQAAVSFRMVTIRA Nicotiana NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAIEAPSTNGFFFGKLPEAYAFLNPIVDIMPVIPLFFFLLAFVWQAAVSFRMVTIRA Oryza NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAALEVPSLNGFFFAKLPEAYAIFNPIVDFMPVIPVLFFLLAFVWQAAVSFRMATLRV Pinus NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVESISIGGPFFGKLPEAYAISDPIVDVMPIIPVLSFLLAFVWQAAVSFRMGSIRL Marchantia NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVEAPAVNGITFAKLPEAYSIFDPIVDVMPIIPLFFFLLAFVWQASVSFRMVNIRP Nephroselm NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLASVDAPAVQGILLATLPEAYLPFRPLVDVLPSIPVLFLLLAFVWQAAVSFRMVKIRP Chlorella NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAVVEAPAVNGLLLAKLPEAYAPFDPIVDVLPVIPVLFLLLALVWQASVSFRMVKIRP Chlamydomo NFNQSVVDSQGRVLNTWADIINRANLGMEVMHERNAHNFPLDLASTNSSSNN*LVLAKLPEAYAPFAPIVDVLPVIPVFFILLAFVWQAAVSFRMAMRTP Mesostigma NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLASVEAPAVNGMILAKLPEAYSIFDPIVDVMPIIPLFFFLLAFVWQASVSFRMIKIQP Cyanophora NFNQSVVDSQGRVISTWADIINRANLGMEVMHERNAHNFPLDLASGEVMPVALLFLAKLPAAYALFDPIVDILPIIPLFFLLLAFVWQAAIGFKMVSIRP Cyanidium NFNQSIVDSQGRVINTWADIINRANLGIEVMHERNAHNFPLDLADNSLLPVASMIINQLPETYNIFAPIIDIMPVIPILFLLLAFVWQAAVGFRMSNIRP Odontella NFNQSVVDSQGRVINTWADIINRADLGMEVMHERNAHNFPLDLASGDVLPVALLLLARLPEAYVVFSPIVDVLPIIPVFFLLLAFVWQAAIGFRMINIRP Guillardia NFNQSVVDSQGRVINTWADILNRANLGIEVMHERNAHNFPLDLASGESLPVALLFLAKLPEAYAIFKPIIDVAPVIPVFFLLLAFVWQAAVGFRMVNIRP Porphyra NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLASGESLPVALLFLAKLPEAYAVFKPIVDILPVIPVFFLLLAFVWQAAIGFRMVNIRP Arabidopsi DEISNIIRERIEQYNREVTIVNTGTVLQVGDGIARIYGLDEVMAGELVEFEEGTIGIALNLESNNVGVVLMGDGLMIQEGSSVKATGKIAQIPVSEAYLG Nicotiana DEISNIIRERIEQYNREVKIVNTGTVLQVGDGIARIHGLDEVMAGELVEFEEGTIGIALNLESNNVGVVLMGDGLLIQEGSSVKATGRIAQIPVSEAYLG Oryza DEIHKILRERIEQYNRKVGIENIGRVVQVGDGIARIIGLGEIMSGELVEFAEGTRGIALNLESKNVGIVLMGDGLMIQEGSFVKATGRIAQIPVSEAYLG Pinus DEISSIIRKQIEQYNNEVRVGNLGTVLQVGDGIARIHGLDEVMAGELVEFGDGTVGIALNLGSDNVGAVLMGDGLMIQEGSSVRATGKIAQIPVSDAYLG Marchantia DEISSIIRKQIEQYNQEVKIVNIGTVLQVGDGIARIYGLDKVMAGELVEFEDGTVGIALNLESDNVGAVLMGDGLTIQEGSSVKATGKIAQIPVSDAYLG Nephroselm DEISNIIRQQIEQYSQEVKVVSVGTVLQVGDGIARIYGLEKVMAGELLEFEDGTVGIALNLEADNVGAVLMGSGLSIQEGSAVKATGKIAQVPVGEAFLG Chlorella DEISSIIKQQIEQYQQEVKAVNVGTVFQVGDGIARIYGLDKVMAGELVEFEDGTVGIALNLEAKNVGAVLMGEGTRVQEGSSVRATGKIAQIPVGDGYLG Chlamydomo EELSNLIKDLIEQYTPEVKMVDFGIVFQVGDGIARIYGLEKAMSGELLEFEDGTLGIALNLEANNVGAVLLGDGLKITEGSRVRCTGKIAEIPVGEAYLG Mesostigma EEISSVIRKQIEQYNQEVKVVNTGTVLQVGDGIARIYGLAKAMAGELLEFEDGTVGIALNLESNNVGAVLMGDGFSIQEGSRVKATGKIAQIPIGESYIG Cyanophora DEISSIIRQQIEQYDQEIQVSNVGTVLQVGDGIARVYGLDKVMSGELLEFEDGTIGIALNLEADNVGVVLMGDGRNILEGSSVRATQKIAQVPVGDAVIG Cyanidium DEISSILKQQIERYNESVKIENTGTVLQVGDGIARIYGLDNIMAGELLEFEEKTIGIALNLETDNVGAVLMGDGRDILEGSSVKGTGKIAQIGVGDNLLG Odontella DEISSIIREQIEQYDQDVKVDNIGTVLQVGDGIARVYGLDQVMSGELLEFEDKTIGIALNLENDNVGVVLMGNGRQILEGSTVKTTGQIAQIPTGEAFLG Guillardia DEISSIIRQQIDKYDQAIQVSNVGTVLQIGDGIARVYGLDQVMAGELLEFEDKTIGIALNLESDNVGVVLMGEGRGILEGSSVKATGKIAQVPVGKSYLG Porphyra DEISSIIRQQIEKYDQDVEVANIGTVLQVGDGIARVYGLDEVMAGELLEFEDKTIGVALNLESDNVGVVLMGDGRDILEGSSVKGTGKIAQIPVGDAFLG Arabidopsi RVINALANPIDGRGKISASESRLIESPAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELIIGDRQTGKTAVATDTILNQQGQNVICVYVAIGQKASSV Nicotiana RVINALAKPIDGRGEISASEFRLIESAAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELIIGDRQTGKTAVATDTILNQQGQNVICVYVAIGQKASSV Oryza RVINALAKPIDGRGEIVASESRLIESPAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELIIGDRQTGKTAVATDTILNQKGQDVICVYVAIGQRASSV Pinus RVVNALAQPIDGKGKISASEFRLIESPAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELIIGDRQTGKTAVATDTILNQKSQNVICVYVAIGQRASSV Marchantia RVVNALAQPIDGKGQIPASEFRLIESPAPGIISRRSVYEPMQTGLIAIDSMIPIGRGQRELIIGDRQTGKTAVAIDTILNQKGQNVVCVYVAIGQKASSV Nephroselm RVVNALARPIDGKGDIASKESRLLEGPAPGIIERRSVYEPMQTGLIAIDAMIPIGRGQRELIIGDRQTGKTAIATDAIVNQKGSGVICVYVAIGQKASSV Chlorella RVVNSLARPIDGKGEIATKENRLIESPAPGIISRRSVHEPLQTGIVAIDAMIPIGRGQRELIIGDRQTGKTAIAVDTILNQKGKDVVCVYVAIGQKASSI Chlamydomo RVVDGLARPVDGKGAVQTKDSRAIESPAPGIVARRSVYEPLATGLVAVDAMIPVGRGQRELIIGDRQTGKTAIAVDTILNQKGKGVICVYVAIGQKASSV Mesostigma RVVDALARPIDGKGDIPSSETRLIESPAPGIISRRSVYEPLQTGLVSVDAMIPIGRGQRELIIGDRQTGKTAVAIDTILNQKGQNVICVYVAIGQKASSV Cyanophora RVVDALARPIDGKGDIATTDTRLIESSAPGIISRKFVYEPLQTGITAIDAMIPIPRGQRELIIGDRQTGKTAVAIDTILNQKGQGVVCVYVAIGQKASSV Cyanidium RVLNALGNPIDGKPNPNSTDYRLIEFNAPGIVSRRSVCEPIQTGITAIDAMIPIGRGQRELIIGDRQTGKTSIALDTIINQKEENVICIYVAIGQKASSV Odontella RVVNPLGAPIDGKGDIANTETRLLEAMAPGIISRKSVCEPLQTGITSIDAMIPIGRGQRELIIGDRQTGKTAIAVDTIINQKTEDVVCVYVGVGQKASTV Guillardia RVVNALGTPIDGKGDINCSETRLIESIAPGIISRKSVCEPIQTGITAIDSMIPIGRGQRELIIGDRQTGKSSVAIDTIINQKGEDVVCVYVAVGQKAATV Porphyra RVVDPLARPIDNKGEPASNGTRLIESMAPGIIGRQSVCEPMQTGITAIDSMIPIGRGQRELIIGDRQTGKTAVALDTIINQKGQDVVCVYVAIGQKASSV Arabidopsi AQVVTSLQERGAMEYTIVVAETADSPATLQYLAPYTGAALAEYFMYREQHTLIIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLS Nicotiana AQVVTTLQERGAMEYTIVVAETADSPATLQYLAPYTGAALAEYFMYRERHTLIIYDDPSKQAQAYRQMSLLLRRPPGREAYLGDVFYLHSRLLERAAKLS Oryza AQVVTTFHEEGAMEYTIVVAEMADSPATLQYLAPYTGAALAEYFMYRERHTLIIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLN Pinus AQVVNTFRERGAMAYTIVVAETADSPATLQYLAPYTGATLAEYFMYKKQHTSIIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLS Marchantia AQVVNTFEDRGALEYTIVVAETANSPATLQYLAPYTGAALAEYFMYRKQHTLIIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLS Nephroselm AQIVTTLQEKDAMRYTIIVSETADSPATLQYLAPYTGAALAEYFMYSGRHTLVIYDDLSKQAQAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLS Chlorella AQVVNTLQERGAMDYTIIVAATADSPATLQYLSPYTGAALAEYFMYTGRHTLVIYDDLTKQAQAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLN Chlamydomo AQVLNTLKERGALDYTIIVMANANEPATLQYLAPYTGATLAEYFMYTGRPTLTIYDDLSKQAQAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLN Mesostigma AQVVSTLEENGAMAYTIIVAENANAPATLQYLAPYTGATLAEFFMYSGRHTLVIYDDLSKQAQAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLS Cyanophora AQVVGVLQEKGALDYTVIVAANADDPATLQYLAPYTGASIAEYFMYKGQHTLVIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLS Cyanidium AQAVTLLEEKDALKYTVVIAANANEPATLQYIAPYTGAAIAEHFMYKGLATLIIYDDLTKQAQAYRQMSLLLKRPPGREAYPGDVFYLHSRLLERAAKLN Odontella AQVVNVLEEKEAMAYTIIVCASANDPATLQYIAPYAGAALAEYFMYNGKATLVIYDDLTKQAMAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLS Guillardia ASIVTTLEEKGALDYTCIVAANADDPATLQYIAPYTGAAIAEYFMYNGQATLVIYDDLSKQASAYREMSLLLRRPPGREAFPGDVFYLHSRLLERAAKLS Porphyra AQVVSSLQEKGALDYTIIVTANADSPATLQYIAPYTGAALAEYFMYKGKATLVIYDDLTKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLN Arabidopsi SQLGEGSMTALPIVETQSGDVSAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFSQFSSDLDKA Nicotiana SSLGEGSMTALPIVETQSGDVSAYIPTNVISITDGQIFLSADLFNSGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFAQFASDLDKA Oryza SLLGEGSMTALPIVETQSGDVSAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKSKLELAQFAELQAFAQFASALDKT Pinus SQLGEGSVTALPIVETQAGDVSAYIPTNAISITDGQIFSSADLFNAGIRPAINVGISVSRVGSAAQIKAMKKVAGKLKLELAQFAELEAFAQFASDLDKA Marchantia SNLGEGSMTALPIVETQAGDVSAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFAQFASDLDKA Nephroselm DALGEGSMTALPVIETQGGDVSAYIPTNVISITDGQIFLSADIFNAGIRPAINVGISVSRVGSAAQVKAMKQVASKLKLELAQFSELEAFAQFSSDLDAA Chlorella DKLGSGSMTALPVVETQEGDVSAYIPTNVISITDGQIFLSADIFNAGIRPAINVGISVSRVGSAAQPKAMKQVAGKLKLELAQFAELEAFSQFASDLDQA Chlamydomo NALGEGSMTALPIVETQEGDVSAYIPTNVISITDGQIFLAAGLFNSGLRPAINVGISVSRVGSAAQPKAMKQVAGKLKLELAQFAELEAFSQFASDLDQA Mesostigma NALGEGSMTALPIIETQAGDVAAYIPTNVISITDGQIFLSADLFNSGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFAQFASDLDKA Cyanophora PQLGEGSMTALPIVETQAGDVCAYIPTNVISITDGQIFLSADLFNSGLRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFDELKAFSQFSSDLDKA Cyanidium NELGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSSDLFNAGIRPSINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFDELQAFSQFASDLDKS Odontella DALGGGSMTALPVIETQASDVSAYIPTNVISITDGQIFLSNDLFNSGIRPAINVGISVSRVGSAAQTKAMKQVAGKLKLELAQFAELEAFSQFASDLDEA Guillardia DKLGGGSMTALPVIETQAGDVSAYIPTNVISITDGQIFLSGDLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFSQFASDLDQA Porphyra SDLGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSGDLFNSGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFSQFASDLDKA Arabidopsi TQNQLARGQRLRELLKQSQSAPLTVEEQIMTIYTGTNGYLDGLEIGQVRKFLVQLRTYLKTNKPQFQEIISTKTLTAEAESFLKEGIQEQLERFMNPLVS Nicotiana TQNQLARGQRLRELLKQSQSAPLTVEEQIMTIYTGTNGYLDSLEVGQVRKFLVELRTYLKTNKPQFQEIISTKTFTEEAEALLKEAIQEQMDRFMNPLIS Oryza SQNQLARGRRLRELLKQSQANPLPVEEQIATIYIGTRGYLDSLEIGQVKKFLDELRKHLKDTKPQFQEIISSKTFTEEAEILLKEAIQEQLERFMNPLIA Pinus TQDQLARGQRLRELLKQSQSAPLTVEEQIATIYTGTNGYLDIFEIAQVRKFLLGLRFYLIKNKPQFGEIISTGTFTEEAKALLEEAFKEHTELFMDPLIS Marchantia TQNQLARGQRLRELLKQSQSAPLSVEEQIATIYTGVNGYLDVLETGQVKKFLIQLREYLVTNKPQFAEIISTKVFTEQAENLLKEAITEHIELFMNPLIS Nephroselm TQAQLARGVRLRELLKQAQSEPLSVADQVATIYTGTNGYLDDLAPTQVRAFLSALRSYLATSKPKYAQIMAANVFTPEAESLVKEAIAETKASFMSPLIA Chlorella TQNQLARGQRLRELLKQSQSSPLSLEDQVASIYAGTNGYLDVLPADRVRAFLVGLRQYLATNKAKYGEILSTNALTDEAQTLLKEALKEYTEEFMNPIVA Chlamydomo TQNQLARGARLREILKQPQSSPLSVEEQVASLYAGTNGYLDKLEVSQVRAYLSGLRSYLANSYPKYGEILSTLTFTPEAEGLVKQAINEYLEEFMNPIVA Mesostigma TQNQLARGRRLRELLKQAQSSPLPVAQQVLTIYAGVNGYLDSIAIEDVKKFLAGLRNYVITSKAAIINNISSKAVTPETEGMMKEAINEYKKVFMSPLIS Cyanophora TQLQLARGERLRELLKQQQYAPLPVEEQVAVIYTGINGFLDNIETKQVSAFISNLRENLSVKRAKFGEIISEKALTAEAENLLKDAISDCKQAFMDATVS Cyanidium TQAQLARGQRLRELLKQPQASPISVYEQIPMIYAGINGFLDDIKIDRISLFIKKLQECLSNSYPHFYEAIESKQLSKENEEVLKKAITEVKKNLMDPIIS Odontella TQKQLARGTRLREVLKQPQNSPLSVAEQVALIYTGINGFLDELEVASVKKYCASLLSFLNTSNNSYIGIVSTNQFTAEAETALKEAISESKAVFMDSIIS Guillardia TRNQLARGQRLREILKQPQNSPISVEEQVAIIYTGINGYLDDIAVDKVRRFVTNLRTNLKNSKPQYAEIINTKTFNSDAENLLKSAIADTKQSFMNPIVS Porphyra TQNQLARGQRLREILKQAQNSPIPVEEQTAIIYTGINGYLDDIAVNKVPDFIIKLREDLKNSKPEFGESISSKKLDTASEELLKKAIEDVKQGFMDSIVS Arabidopsi AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLFANPFVMTIALGKDEKDLFDIMDDWLRRDRF Nicotiana AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLFANPFVMTIALGKDENDLFDIMDDWLRRDRF Oryza AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLFANPFVMTIALGKEENDLFDIMDDWLRRDRF Pinus AASVIAAGLSVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLFANPFVMTIALGKEEKTLFDTVDDWLRRDRF Marchantia AASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLFANPFVMTIAIGKEPKGLFDSMDDWLRRDRF Nephroselm AASVVAAGLAVGLASIGPGIGQGTAAGQAVGGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLFANPFVMTIAIGEEKRGLFDDMDDWLRRDRF Chlorella AASVIAAGLAVGLAAIGPGMGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIYGLVVALALLFANPFAMTIAIGQEKRGLFDVVDDWLRRDRF Chlamydomo ATSVVSAGLAVGLAAIGPGMGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIYGLVVALALLFANPFAMTIAIGQEKRTWFDDADDWLRQDRF Mesostigma AASVLAAGLAVGLASIGPGVGQGTAAGQALEGIARQPEAEGKIRGTLLLSFAFMESLTIYGLVVALALLFANPFVMTISIDKAEPSIFDLCDDWLKRDRF Cyanophora AASVIAAALAVGLAAIGPGIGQGTAAGQAVEGIARQPEVDGKIRGTLLLSLAFMEALTIYGLVVALALLFANPFVMTVAIGDSERGWFDVLDDWLKRDRF Cyanidium AASVIAAGLAVGLAAIGPGIGQGSAAANAVEGLARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALSLLFANPFIMTIAIGEQERGWFDLLDDWLKRDRF Odontella AASVIAAGLAIGLAAIGPGIGQGNAAGQAVEGIARQPEGENKIRGTLLLSLAFMEALTIYGLVVALALLFANPFNMTIAIGNQERGLFDLIDDWLKKDRF Guillardia AASVVASGLSVGLAAIGPGIGQGTAAAQAVEGIARQPEAEGRIRGTLLLSLAFMESLTIYGLVVALALLFANPFTMTIAIGEEGRGWFDLVDDWLKRDRF Porphyra AASVIAAGLAVGLAAIGPGIGQGSAAANAVEGIARQPEVEGKIRGTLLLSLAFMESLTIYGLVVALSLLFANPYVMTIAIGEKTRGGFDLVDDWLKRDRF Arabidopsi VFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWAFVALHGAFALIGFML Nicotiana VFVGWSGLLLFPCAYFAVGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGAFGLIGFML Oryza VFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGAFALIGFML Pinus VFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDLTRWCQLGGLWTFVALHGAFGLIGFML Marchantia VFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGAFGLIGFML Nephroselm VFVGWSGLLLLPCAYFAVGGWLTGTTFVTSWYTHGLASSYLEGCNVLTAAVSTPANSMAHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGSFGLIGFML Chlorella VFVGWSGLLLFPTAYLALGGWFTGTTFVTSWYTHGLATSYLEGCNFLTAAVSTPANSMGHSLLFLWGPEAQGDFTRWCQLGGLWTFVALHGSFALIGFML Chlamydomo VFVGWSGLLLFPCAYFALGGWLTGTTFVTSWYTHGLATSYLEGCNFLTAAVSTPANSMAHSLLFVWGPEAQGDFTRWCQLGGLWAFVALHGAFGLIGFML Mesostigma VFIGWSGLLLLPCAYFALGGFFTGNTFVTSWYTHGLASSYLEGCNVLTAAVSTPSNAMGHSLLLLWGPEAQGDFTRWCQLGGLWTFTALHGAFGLIGFML Cyanophora VFLGWSGLLLLPCAYLAVGAWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSMGHSILFVWGPEAQGDFTRWCQIGGLWTFTALHGALGLIGFTL Cyanidium VFIGWSGILLFPCAYLALGAWFTGTTFVSSWYTHGLASSYLEGCNFLTAAVSSPANSMGHSLLFLWGPEAQGDFTRWCQIGGLWTFTALHGSFGLIGFCL Odontella VFIGWSGLLLFPTAYLAAGGWMTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSMGHSLLLLWGPEAQGDFTRWCQIGGLWAFIALHGAFGLIGFCL Guillardia VFIGWSGLLLFPTSYLSIGGWFTGTTFVTSWYTHGLASSYLEGCNFFTAAVSTPANSMGHSLLLLWGPEAQGDFTRWCQIGGLWAFCALHGAFGLIGFCL Porphyra VFVGWSGLLLFPCAYLAVGGWLTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSMGHSLLFLWGPEAQGDFTRWCQIGGLWAFIALHGSFGLIGFCL Arabidopsi RQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGD Nicotiana RQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGD Oryza RQFELARSVQLRPYNAISFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGD Pinus RQFELARSVQLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGD Marchantia RQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGD Nephroselm RQFEIARAIGLRPYNAIAFSGPISVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGD Chlorella RQFEIARSVKIRPYNAIAFSAPISVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGD Chlamydomo RQFEIARSVNLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGD Mesostigma RQFEIARAVKIRPYNAIAFSGPIAVFVSVFLIYPLGQQSWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGD Cyanophora RQFEIARLIGLRPYNAIAFSGPIAVFVSVFLLYPLGQAGWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGD Cyanidium RQFEIARLVGLRPYNAIAFSGPIAVFVSVFLLYPLGQASWFFAPSFGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGE Odontella RQFEIARLVGIRPYNAIAFSGPIAVFVSVFLLYPLGQASWFFAPSFGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGD Guillardia RQFEIARLVGIRPYNAIAFSGPIAIFVSVFLMYPLGQASWFFAPSLGVAAIFRFLLFIQGFHNFTLNPFHMMGVAGILGAALLCAIHGATVQNTIFEDGD Porphyra RQFEIARLVGLRPYNAIAFSGPIAVFVSVFLMYPLGQASWFFAPSLGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVQNTLFEDGD Arabidopsi GANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRA Nicotiana GANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRA Oryza GANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRA Pinus GANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFVSQEIRAAEDPESETFYTKNILLNEGIRA Marchantia GANTFRAFNPTQSEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRA Nephroselm GANTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFVSQELRAAEDPEFETFYTKNLLLNEGIRA Chlorella GANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRA Chlamydomo GANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLLVPVTGLWMSAIGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRA Mesostigma AANTFRAFNPTQSEETYSMVTANRFWSQIFGVAFANKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNLLLNEGIRA Cyanophora GSNTFPAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLGVNLRAYDFVSQEIRAAEDPEFETFYTKNLLLNEGIRA Cyanidium ASDTFRAFTPTQSEETYSMVTANRFWSQIFGVAFANKRWLHFFLLFVPVTGLWVSSIGIVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRA Odontella AANTFRAFTPTQSEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWTSAIGIVGLALNLRAYDFVSQELRAAEDPEFETFYTKNILLNEGIRA Guillardia AANTFRAFTPTQSEETYSMVTANRFWSQVFGVAFSNKRWLHFFMLFVPLAGLWTSAIGIVGLALNLRAYDFVSQELRAAEDPEFETFYTKNLLLNEGIRS Porphyra AADTFRAFTPTQSEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWTSAFGIVGLALNLRAYDFVSQELRAAEDPEFETFYTKNILLNEGIRS Arabidopsi WMAAQDQPHENLIFPEEVLPRGNALLFNGTLAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHL Nicotiana WMAAQDQPHENLIFPEEVLPRGNALLFNGTLAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHL Oryza WMAAQDQPHENLIFPEEVLPRGNALLFNGTLAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHL Pinus WMAAQDQPHENLIFPEEVLPRGNALLFNGTLAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHL Marchantia WMAAQDQPHENLVFPEEVLPRGNALLFNGTLGGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHL Nephroselm WMAAQDQPHEKLVFPEEVLPRGNALLFNGTVGGRDQESTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHL Chlorella WMAAQDQPHEKLVFPEEVLPRGNALLFNGSVGGRDQESTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHL Chlamydomo WMAAQDQPHERLVFPEEVLPRGNALLFNGTVGGRDQETTGFAWWSGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVSHFVPEKPMYEQGLILLPHI Mesostigma WMAAQDQPHENLVFPEEVLPRGNALLFNGTISGRDQESTGFAWWSGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAHFTPEKPMYEQGLILLPHL Cyanophora WMAVQDQPHENFVFSEEVLPRGNALLFNSSVSGRDQQSTGFAWWSGNARLINLSGKLLGAHVAHAGLIVFWTGAMTLFEVAHFIPEKPMYEQGLILLPHL Cyanidium WMAAQDQPHENFVFPEEVLPRGNALLFNKDIGGRSIESTGFAWWSGNARLINLSGKLLGAHVAHAGLIVFWTGAMTLFETSHFIPEKPLYEQGMILLPHL Odontella WMAAQDQPHENFVFPEEVLPRGNALPFNSSIAGRDIESTGFAWWSGNARLINVSGKLLGAHVAHAGLMVFWAGAMVLFEVSHFVPEKPTYEQGFILIQHL Guillardia WMAAQDQPHENFIFPEEVLPRGNALPFNSNIAGRDIESTGFAWWSGNSRLINVSGKLLGAHVAHAGLMVFWCGAMTLFEVAHYIPEKPLYEQGLILLPHL Porphyra WMAAQDQPHENFIFPEEVLPRGNALPFNTNVGGRDIESTGFAWWSGNARLINVSGKLLGAHVAHAGIMVFWTGAMTLFEVAHFVPEKPLYEQGLILIPHL Arabidopsi ATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHALLGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGVGAFLLVFKALYFGGVYDTWAPG Nicotiana ATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHALLGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGLGAFLLVFKALYFGGVYDTWAPG Oryza ATLGWGVGPGGEVLDTFPYFVSGVLHLISSAVLGFGGIYHALLGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGIGAFLLVLKALYFGGIYDTWAPG Pinus ATLGWGVGPGGEIVDTFPYFVSGVLHLISSAVLGFGGIYHALIGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGVGAFLPVLKALYFGGVYDTWAPG Marchantia ATLGWGVGPGGEIVDTFPYFVSGVLHLISSAVLGFGGIYHALIGPETLEESFPFFGYVWKDKNKMTTILGIHLILLGAGAFLLVFKALYFGGIYDTWAPG Nephroselm ATLGYGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGVYHSLIGPETLEESFPFFGYVWKDKNKMTTILGIHLVLLGLGALLLVLKARYLGGVYDTWAPG Chlorella ATLGYGVGPGGEVIDTYPYFVSGVLHLISSAVLGFGGVYHSLVGPETLEESFPFFGYVWKDKNKMTTILGIHLIVLGFGAWLLVWKAMYFGGIYDTWAPG Chlamydomo ATLGYGVGPGGEIIDTFPYFVSGVLHLISSAVLGFGGVYHSLIGPETLEESYPFFGYVWKDKNKMTNILGYHLIMLGLGAWLLVWKAMYFGGVYDTWAPG Mesostigma ATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGVYHSLIGPETLEESFPFFGYVWKDKNKMTTILGIHLIVLGVGAYLLVWKACYFGGVYDTWAPG Cyanophora ATLGWGVGPGGEVIDVYPYFVVGVLHLVSSAVLGFGGLYHAIIGPEVLEESFPFFGYDWKDKNKMTTIIGIHLILLGSGALLLVLKAMFFGGVYDTWAPG Cyanidium ATLGWGVAPGGEIVNTYPYFATGVIHLVSSAVLGFGGIYHSIVGPDVLEDSFSFFGYDWRDKNKMTTILGIHLILLGIGAFLLVIKALFIGGIYDTWAPG Odontella ATLGYGIGPGGEITSTVPYFAVGVIHLISSAVLGFGGIYHSLLGPDTLEESFPFFGYDWRDKNKMTTILGIHLCLLGVGSFLLVIKAMYLGGVYDTWAPG Guillardia ATLGWGVGPGGEIIDVYPYFVVGVLHLISSAVLGFGGVYHSLIGPDTLEESFPAFGYDWRDKNKITTILGIHLVILGFGALLLVIKAIYVGGLYDTWAPG Porphyra ATLGWGVGPGGEIFNTYPYFVVGVVHLISSAVLGFGGLYHSLIGPDTLEESFPFFGYDWRDKNKMTTILGIHLVLLGIGAFLLVIKSLFVGGVYDTWAPG Arabidopsi GGDVRKITNLTLSPSVIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICIFGGIWHILTKPFAWARRALVWSGEAYLSYSLAALSVCGFIACCFVWF Nicotiana GGDVRKITNLTLSPSIIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICILGGIWHILTKPFAWARRALVWSGEAYLSYSLGALSVFGFIACCFVWF Oryza GGDVRKITNLTLSPGVIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGFICVFGGIWHILTKPFAWARRAFVWSGEAYLSYSLGALSVFGFIACCFVWF Pinus GGDVRKITNPTLNPSAIFGYLLKSPFGGEGWIVSVDNLEDVIGGHVWLGSICIFGGIWHILTKPFAWARRAFVWSGEAYLSYSLAALSLFGFIACCFVWF Marchantia GGDVRKITNLTLSPGVIFGYLLKSPFGGEGWIVSVDNLEDIIGGHVWLGSICIFGGIWHILTKPFAWARRALVWSGEAYLSYSLGAIAVFGFIACCFVWF Nephroselm GGDVRVITNPTTSPAVIFGYILKSPFGGEGWIVSVDNMEDVIGGHLWIGLLCVFGGIWHILTKPFGWARRAFVWSGEAYLSYSLGAISVMGFIACCFVWF Chlorella GGDVRIISNPTVSPGVIFSYILKSPFGGDGWIVSVDNMEDVIGGHIWIGTLCIFGGIWHILTKPWAWARRAFVWSGEAYLSYSLGAIALMGFTACCMSWF Chlamydomo GGDVRVITNPTTNAAVIFGYLVKSPFGGDGWICSVDNMEDIIGGHIWIGTLEILGGIWHIYTTPWPWARRAFVWSGEAYLSYSLGAIGVMGFIACCMSWF Mesostigma GGDVRIITDPTLSPAVIFGYLLKSPFGGEGWICSVDNMEDVIGGHIWIGNLLIFGGIWHILTKPWAWARRAFVWSGEAYLSYSLGAIATMGWIACCFSWF Cyanophora GGDVRVISNPTLNPTVIFSYITKSPWGGDGWIVSVDNMEDIIGGHIWLAFICIIGGVWHILTKPFSWARRALVWSGEAYLSYSLAALALMGFIANCFVWF Cyanidium GGDIRFITNPTLNPAIIFSYLLKSPFGGEGWIVGVNNMEDVIGGHIWIGVTCVIGGIWHILTRPFSWARRAFVWSGEAYLSYSLGALALMGQTAAEYAWY Odontella GGDVRLITTPTLNPIVIFGYVFRSPFGGDGWVVSVNNMEDIIGGHIWVGLLCIIGGIWHIFTKPFAWARRAFVWSGEAYLSYSLAAISLMGFTAALYSWY Guillardia GGDVRIIDNPTLNPAVIFGYVLKSPWGGDGWIVSVNNMEDVVGGHIWIGFTCIAGGFWHILTKPFAWARRAYVWSGEAYLSYSLVAVSLMAFIASQYAWY Porphyra GGDVRFVSNPTLNPLVIFGYVLKSPFGGDGWIVSVNNMEDLIGGHVWIGIICIAGGIWHILTKPFAWARRAFVWSGEAYLSYSLGALSIMGLTASNFVWY Arabidopsi NNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNGLDLSRLKKDIQPWQERRS Nicotiana NNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNGLDLSRLKKDIQPWQERRS Oryza NNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNGLDLSRLKKDIQPWQERRS Pinus NNTVYPSEFYGPTGPEASQAQAFTFLVRDQRLGASVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDLRAPWLEPLRGPNGLDLSKLRKDIQPWQERRS Marchantia NNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTGLGKYIMRSPTGEIIFGGETMRFWDLRAPWLEPLRGPNGLDLSKLKKDIQPWQERRS Nephroselm NNTVYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDTRAPWIEPLRGPNGLDLSKLKNDIQPWQERRS Chlorella NTTAYPSEFYGPTGPEASQSQTFTFLVRDQRLGANVASAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKLKNDIQPWQERRA Chlamydomo NNTAYPSEFYGPTGPEASQSQAFTFLVRDQRLGANVASAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKLKNDIQPWQERRA Mesostigma NNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANIASSQGPTGLGKYLMRSPSGEIIFGGETMRFWDCRAPWIEPLRGPNGLDLNKLKNDIQPWQERRS Cyanophora NNTAYPSEFFGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTGLGKYLMRSPSGEIIFGGETMRFWDTRAPWLEPLRGANGLDLTKIKYDIQPWQERRA Cyanidium NNTVYPSEFYGPTAAEASQAQAFTFLVRDQRLGANIASTQGPTGLGKYLMRSPTGEVILGGETMRFWDLRAPWLEPLRSSNGLDLNKIKNDIQPWQERRA Odontella NNTAYPSELYGPTGPEASQSQAFTFLVRDQRLGANVSSAQGPTGLGKYLMRSPSGEIIFGGETMRFWDLRAPWVEPLRGPNGLDINKIKNDIQPWQERRA Guillardia NNTVYPSEFYGPTGPEASQSQAFTFLVRDQRLGASVSSAQGPTGLGKYLMRSPSGEIILGGETQRFWDLRAPWIEPLRGPNGLDLNKIKNDIQPWQERRA Porphyra NNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVASSQGPTGLGKYLMRSPSGEIIFGGETMRFWDLRAPWVEPLRGPNGLDLNKIKNDIQPWQERRA Arabidopsi AEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLSTSHFVLGFFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLNMAKKSLIYREKKRQKLEKK Nicotiana AEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLGFFFFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLNMARKSLIQREKKRQKLEQK Oryza AEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLGFFFFVGHLWHAGRARAAAAGFEKGIDRDLEPVLYMTPLNMAKKSLIQRERKRQKLEQK Pinus AEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLSTSHFVLGFFFFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLNMARKSLIQREKKRQALERK Marchantia AEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLGFFFFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLNMAKKSLIQREKKRQNLEKK Nephroselm AEYMTHAPLGSLNSVGGVATEINAVNFVSPRSWLSTSHFVLGFFFFVAHLWHAGRARAAAAGFEKGIDRDTEPTLFMRPLDMAKKSMIERESKRAALVAK Chlorella AEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFCLGFFFFVGHLWHAGRARAAAAGFEKGIDRDNEPVLSMRPLDMAKKSMIERDRKRARLITK Chlamydomo AEYMTHAPLGSLNSVGGVATEINAVNFVSPRSWLACSHFCLGFFFFIGHLWHAGRARAAAAGFEKGIDRFDEPVLSMRPLDMAKKSMIQRELKRQKLVMK Mesostigma AEYMTHAPLGSLNSVGGVATEINAVNFVSPRSWLATSHFTLAFFFFVGHLWHAGRARAAAAGFEKGIERETEPVLFMKPLDMAKKSMIEREKKRQKLVNK Cyanophora AEYMTHAPLGSLNSVGGVATEINSVNYVSPRSWLSTSHFVLGFFLFIGHLWHAGRARAASGGFEKGLDRENEPVLSMKLLDMAKKSMIERDKKRENLMNK Cyanidium AEYMTHAPLGSLNSVGGVATEINSVNYVSPRSWLTTSHFFLGFFIFIGHLWHAGRARAAAAGFEKGINRENEPVLSMRPLDMAKKSVIQRNINRLKLINK Odontella AEYMTHAPLGSLNSVGGVATEINSVNYVSPRSWLCCSHFFLAFFFLIGHWWHSGRARAAAAGFEKGINRANEPVLSMRPIDMAKKSMIEREKKRIKLNNK Guillardia AEYMTHAPLGSLNSVGGVATEINSVNYVSPRSWLTTSHFFLGFAFYIGHLWHAGRARAAAAGFEKGINRENEPVLTLRPIDMAKKSMIERERKREELVSK Porphyra AEYMTHAPLGSLNSVGGVATEINSVNYVSPRSWLTTSHFFLGFFLFIGHLWHAGRARAAAAGFEKGINRENEPVLSMRPLDMAKKNMIQREIKREKLEKK Arabidopsi YHLIRRSSKKEKIPSLSEKWKIHGKLMALRFPRFSQGLAQDPTTRRIWFGIATAHDFESHDDITEERLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNF Nicotiana YHSIRRSSKKEKVPSLSDKWEIYGKLMALRFPRFSQGLAQDPTTRRIWFGIATAHDFESHDDITEERLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNF Oryza YHLIRRSSKKKKVYPLSEKTKMREKLMELRFPRFSQGLAQDPTTRRIWFGIATAHDFESHDDITEERLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNF Pinus YHLIRQSLEEKKVSSLDDKWEIHRKLMASRFPKFSQGLAQDPTTRRIWFGIATAHHFESHDDITEERLYHKIFASHFGQLAIIFLWTSGNLFHVAWQGNF Marchantia YKILRNSLKKKETSSLDEKWEFQKKLMASRFPKFSQGLSQDPTTRRIWFGIATAHDFESHDDMTEERLYQKIFASHFGQLAIIFLWTSGNLFHVAWQGNF Nephroselm YATRRQALKAAKTKSFDERLVLQHQLMATKFPKFSQGLAEDPTTRRIWYGIATAHDFESHDGMTEESLYQKIFASHFGQLAIIFLWTSGNLFHVAWQGNF Chlorella YAAKRKNLLVETATSLEDKFNLHRKLMATKFPKFSQALAQDPTTRRLWFGIATAHDFESHDGMTEERLYQKIFASHFGQLAIIFLWTSGNLFHVAWQGNF Chlamydomo YATKRAALKEQQTTFLKEKLSLHRKFMATKFPKFSQGLARDPATRIIWYGLAMAHDFESHDVWTEENLYQKIISSHFGQLSIIFLWTSGNLFHVAWQGNF Mesostigma YAVKRKELKEQTSVSFEERFKLQLELMATKFPKFSQGLAQDPTTRRIWFGIATAHDFESHDGMTEENLYQKIFASHFGQLAIIFLWTSGNLFHVAWQGNF Cyanophora YLVKRQQLKTRETDSVEEKLLLNQELMGTKFPKASQALAQDPTTRRIWYGIATANDFETNDGITEENLYQKIFASHFGHLAIIFLWTSGNLFHVAWQGNF Cyanidium YSAQREAIKNERTSKVEKKISLYSNIMATKFPKFSQSLSSDPTTRRIWYGIATSHDFEAHDNVTEENLYQKIFASHFGHLAIIFLWTSGNLFHVAWQGNF Odontella YTPKRNTLLQAQTEDFQSRLDIHSKIMATKFPKFSQALAQDPATRRIWYGIATAHDLEAHDGMTEENLYQKIFASHFGHLAVIFLWTAGNLFHVAWQGNF Guillardia YEKKRLELKSKKTAEYEEKLEVYKKIMATKFPKFSQALAQDPATRRIWYGLATAHDFESHDGMTEENLYQKIFASHFGHLAIIFLWTSGNLFHVAWQGNF Porphyra YYLKRLAIKEQKTTSFAEKIELRQKLMATKFPKFSQALSQDPTTRRIWYGIATAHDFESHDGMTEENLYQKIFASHFGHLAIIFLWTSGNLFHVAWQGNF Arabidopsi ETWVQDPLHVRPIAHAIWDPHFGQPAVEAFTRGGAGPVNIAYSGVYQWWYTIGLRTNEDLYTGALFLLFLSALSLIGGWLHLQPKWKPRVSWFKNAESRL Nicotiana ESWVQDPLHVRPIAHAIWDPHFGQPAVEAFTRGGAGPVNIAYSGVYQWWYTIGLRTNEDLYTGALFLLFLSAISLIAGWLHLQPKWKPSVSWFKNAESRL Oryza ESWIQDPLHVRPIAHAIWDPHFGQPAVEAFTRGGAGPVNIAYSGVYQWWYTIGLRTNEDLYTGALFLLFLSTLSLIGGWLHLQPKWKPSLSWFKNAESRL Pinus EAWVRDPLHVRPIAHAIWDPHFGQPAIEAFTRGGAGPVNIAYSGVYQWWYTIGLRTNEDLYAGALFLLFLSVIFLIAGRLHLQPKWRPSVSWFKNAESRL Marchantia EAWGQDPLHVRPIAHAIWDPHFGQPAVEAFTRGGAGPVNIAYSGVYQWWYTIGLRTNQDLYNGALFLVILSSISLIAGWLHLQPKWKPKVSWFKNAESRL Nephroselm EQWGQDPLHVRPIAHAIWDPHFGQPAVEAFTRGGAGPVNISYSGVYQWWYTIGMRSSNDLYTGALFLLVGAAILLFAGWLHLQPKFQPSLSWFKNAESRL Chlorella EQWVQDPLHIRPIAHAIWDPHFGQAAVEAFTRGGAGPVNISTSGVYQWWYTIGIRTNQELYVGSIFLLVLAGLFLFAGWLHLQPSFQPALSWFKNAESRL Chlamydomo EQWVTDPVHIRPICHAIWDPHFGQPAVEAFTRGGAGPVNISTSGVYQWWYTIGMRTNQDLYVGSVFLALVSAIFLFAGWLHLQPNFQPSLSWFKDAESRL Mesostigma ERWVADPLHVRPIAHAIWDPHFGQPAVEAFTRGGAGPVNISYSGVYQWWYTIGMRSNTDLYIGALFLLITASMTLFAGWLHLQPQFKPSLSWFKNAESRL Cyanophora EQWVKDPLNTRPIAHAISDPHFGQRAIEAFSQAGASPVNISYSGVYQWWYTQGMRTNEELYNGAIFLLILSALSLFAGWLHLQPKFRPNLSWFKNAESRL Cyanidium EAWIANPLKVKPVAHAIWDPHFGQAALKAFSRGGVYPVDISYSGVYHWWYTIGMRTSSDLYAGALFLLVLAALCMFAGRLHLQPKFKPSISWFKNNESRL Odontella EQWVAKPLKVRPIAHSIWDPHFGESALKAFSKGNTYPVNIAFSGVYQWWYTIGFRTNQELYLGSVGLLLLSCALLFAGWLHLQPKFRPSLSWFKNNESRL Guillardia EQWVLNPLKVKPIAHAIWDPHFGQPAVKAFTKGGVYPVNIATSGVYHWWYTIGMRTNNDLYSGSIFLLILASVMLFAGWLHLQPKFRPGLAWFKNNESRL Porphyra EQWILNPLKVKPIAHAIWDPHFGQPALKAFSKGGSYPVNIAYSGVYHWWYTIGMRTNQDLYTGALFLLVLSAILLFGGWLHLQPKFKPGLSWFKNNESRL Arabidopsi NHHLSGLFGVSSLAWTGHLVHVAIPASKYVRWNNFLNVLPHPQGLGPLFTGQWNLYAQNPDSSSHLFGTSQGSGTAILTLLGGFHPQTQSLWLTDMAHHH Nicotiana NHHLSGLFGVSSLAWTGHLVHVAIPASKYVRWNNFLDVLPHPQGLGPLFTGQWNLYAQNPDSSSHLFGTAQGAGTAILTLLGGFHPQTQSLWLTDIAHHH Oryza NHHLSGLFGVSSLAWTGHLVHVAIPASKYVRWNNFLDVLPYPQGLGPLLTGQWNLYAQNPDSSNHLFGTTQGAGTAILTLLGGFHPQTQSLWLTDIAHHH Pinus NHHLSGLFGVSSLAWTGHLVHVAIPESMHVRWDNFLDVLPHPEGLEPLFTGQWNLYAQNPDSSSHLFGTSQGAGTAILTFLGGFHPQTQSLWLTDMAHHH Marchantia NHHLSGLFGVSSLAWTGHLVHVAIPESKHVRWDNFLTKLPHPEGLGPFFAGQWNIYAQNVDSSNHAFGTSQGAGTAILTFIGGFHPQTQSLWLTDIAHHH Nephroselm NHHLAGLFGVSSLAWTGHLVHVAIPESKHVGWDNFLTTLPHPAGLAPFFNGNWSVYAQNPDSASHLFGTSTGAGTAILTFLGGFHPQTQSLWLTDMAHHH Chlorella NHHLAGLFGVSSLAWTGHLVHVAIPESKHVGWDNFLTVLPHPAGLTPFFTGNWAAYAENPDSLSQLFGTGEGSGTAILTFLGGFHPQTQSLWLTDMAHHH Chlamydomo NHHLSGLFGVSSLAWTGHLVHVAIPELQHVGWDNFLSVLPHPQGLTPFFTGNWAAYAQSPDTASHVFGTAQGSGQAILTFLGGFHPQTQSLWLTDMAHHH Mesostigma NHHLSGLFGVSSLAWTGHLIHVAIPESKHVRWDNFLNVLPHPAGLSPFFTGNWAAYAQNPDSTSHIFSTSQGAGTAILTFLGGFHPQTQSLWLTDIAHHH Cyanophora NHHLGGLFGTSSLAWTGHIVHVAIPESKHVGWDNFLQVAPHPAGLQPFFTGNWGVYTENPDTANHVFGSSDGAGTAILTFLGGFHPQTQSLWLTDIAHHH Cyanidium NHHLSGLFGLSSLAWCGHLIHVAIPASKHIGWNNFLTTPPHPAGLKPFFTGNWSDYSLNPDDPSHIFGTSSNSGKAILTFLGGFHPQTQSLWLTDIAHHH Odontella NHHLSGLMGVSSLAWTGHLVHVALPASVHVGWDNFLTTPPHPAGLTPFFTGNWTVYAQNPDSPSHVYGTSEGAGTRILTFLGGFHPQTQSLWLSDIAHHQ Guillardia NHHLSGLFGFSSVAWSGHLIHVAIPESIHVGWDNFTKVYPHPEGLKAFFTGNWSNYAANPDTADHIFGTTEGSGTAILTFLGGFHPQTQSLWLTDIAHHH Porphyra NHHLSGLFGVSSLAWTGHLVHVAIPESKHVGWDNFTTVLPHPAGLQPFFSGNWSVYAQNPDTAQQLFGTNEGAGTAILTFLGGFHPQSQSLWLTDMAHHH Arabidopsi LAIAILFLIAGHMYRTNFGIGHSIKDLLEAHIPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQY Nicotiana LAIAFIFLVAGHMYRTNFGIGHSMKDLLDAHIPPGGRLGRGHKGLYDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQY Oryza LAIAFIFLIAGHMYRTNFGIGHSIKDLLEAHTPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDFTTQAALYTHHQY Pinus LAIALVFSIAGHMYRTNFGIGHSMEDILEAHVPPGGLLGRGHKGLYNTINNSLHFQLGLALASLGVITSLVAQHMYSLPPYAFIAQDFTTQAALYTHHQY Marchantia LAIAVVFIIAGHMYRTNFGIGHSIKEILETHTPPGGRLGRGHKGLYDTINNSLHFQLGLALASLGVITSLVAQHMYSLPPYAFLAQDFTTQAALYTHHQY Nephroselm LAIAVVFILAGHMYRTNFGIGHSMREILEAHRAPSGRLGLGHKGLFDTVNNSLHFQLGLALASLGVITSLVAQHMYSLPPYAFMAQDFTTMSALYTHHQY Chlorella LAIAVVFILAGHMYRTIFGIGHSMREILEAQTPPSGRLGAGHKGLYDTVNNSLHFQLGLALASVGTICSLVAQHMYSLPPYAFLAQDFTTQASLYTHHQY Chlamydomo LAIAVIFIVAGHMYRTNFGNGHRMQAILEAHTPPSGSLGAGHKGLFDTVNNSLHFQIGLALASVGTITSLVAQHMYSLPPYAFQAIDFTTQAALYTHHQY Mesostigma LAIAVLFIVAGHMYRTNFGIGHSMREILEAQRPPGGRLGAGHSGLYDTVNNSLHFQLGLALASLGVITSVVAQHMYSLSPYAFLAQDFTTQAALYTHHQY Cyanophora LAIAVLFIVAGHMYRTNFGIGHSIKEILNGHRPPGGRLGAGHVGLYDTVNNSLHFQLGLALAALGVITSLVAQHMYSIPPYAYLARDFTTQAALYTHHQY Cyanidium LAIAVIFIIAGHMYRTNFGIGHNIKDILEAHKPPSGKMGLGHKGLFNTISNSLHFQLGLALACLGVLSSLTAQHLYSIPPYAFISRDFVTQAALYTHHQY Odontella LAIAFVFIIAGHMYRTNFGIGHNMKEILDAHRPPGGRLGAGHVGLFETITNSLHIQLGLALACLGVATSLTAQHMYALTPYAYLSKDFTTEAALYTHHQY Guillardia LAIGVIFIFAGHMYRTNWGIGHSLKEILDAHRAPSGRLGNGHKGLFETISNSLHFQLGLALASLGVITSLVAQHMYALPSYAFIAKDYVTQAALYTHHQY Porphyra LAIAVVFIVAGHMYRTNWGIGHNLKDILDAHRPPSGRLGAGHRGLFDTITNSLHMQLGLALAALGVITSLVAQHMYAMPPYAFMAKDFTTQASLYTHHQY Arabidopsi IAGFIMTGAFAHGAIFFIRDYNPEQNEDNVLARMLDHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVL Nicotiana IAGFIMTGAFAHGAIFFIRDYNPEQNEDNVLARMLEHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVL Oryza IAGFIMTGAFAHGAIFFIRDYNPEQNEDNVLARMLDHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTTYGFDIL Pinus IAGFIMTGAFAHGAIFLIRDYNPEQNKDNVLARMLEQKEAIISHLSWVSLLLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTLYGFDIL Marchantia IAGFIMTGAFAHGAIFFIRDYNPEQNKDNVLARMLEHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKALYGFDVL Nephroselm IAGFIMTGAFAHGAIFFIRDYDPIQNEGNVLARMLEHKEALISHLSWVTLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPVFAQWIQASHGKALYGFDVL Chlorella IAGFIMCGAFAHGAIFFVRDYDPEANRGNVLARVLDHKEAIISHLSWVSLFLGFHTLGLYVHNDVVQAFGTPEKQILIEPVFAQWIQAAHGKTVYGFDFL Chlamydomo IAGFIMCGAFAHGAIFFIRDYDPEQNKGNVLARMLDHKEALISHLSWVSLFLGFHTLGLYVHNDVMQAFGTPEKQILIEPVFAQWIQAAHGKALYGFDFL Mesostigma IAGFIMTGAFAHGAIFFIRDYDPELNKDNVLARMLEHKEAIISHLSWASLFLGFHTLGLYVHNDVMQAFGTPEKQILIEPVFAQWIQASHGKSLYGFDVL Cyanophora IAGFLMVGAFAHGAIFLVRDYDAEQNKNNVLARIIDHKEAIISHLSWVSLFLGFHTLGLYVHNDVVQAFGTPEKQILIEPVFAQWIQSVHGKSLYGFEVL Cyanidium IAGFLMVGAFAHGAIFFVRDYDPKQNKDNVLYRMLEHKEAIISHLSWVSLFLGFHTLGLYVHNDVVVAFGNPEKQILIEPIFAQWIQATSGKTLYGFNVL Odontella IAGFLMVGAFAHGAIFFVRDYDPELNKNNVLARMLEHKEAIISHLSWASLFLGFHVLGLYIHNDTVVAFGQPEKQILFEPLFAEYIQAASGKAVYNFNVL Guillardia IAGFLMVGAFAHGAIFFVRDYDPEQNKNNVLARMLEHKEAIISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILVEPVFAQWIQASSGKAMYGFDVL Porphyra IAGFLMVGAFAHGAIFFVRDYDPEQNKGNVLARMLEHKEAIISHLSWVTLFLGFHTLGLYVHNDTMIAFGTPEKQILIEPVFAQWIQASSGKALYGFDVL Arabidopsi LSSTSGPAFNAGRSIWLPGWLNAINENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFY Nicotiana LSSTSGPAFNAGRSIWLPGWLNAVNENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFY Oryza LSSTSGPAFNAGRTLWLPGWLNAVNENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFY Pinus LSSTSGPSFDAGKSIWLPGWLNAINDNNNSLFSTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSRLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFY Marchantia LSSTNNPAFNAGQSIWLPGWLDAINNNSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGPGRGGTCDISAWDAFY Nephroselm LSSADSPATSASQSIWLPGWLDAINSSSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFY Chlorella LSSATSAPSLAGQSLWLPGWLQGINSDTNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFY Chlamydomo LSSKTSAAFANGQSLWLPGWLDAINNNQNSLFLTIGLGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAYDAFY Mesostigma LSSSSSFAASASDSIWLPGWLDAINSNSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFY Cyanophora LNNADSITRVAPQPIWLPGWLDAINSGNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFY Cyanidium LASSSSSATQAAQSLWLPNWLEAINNNNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFY Odontella LSSSTNPATIAGNQVWLPGWLEAINNSKTDLFLKIGPGDFLVHHAIALGLHVTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFY Guillardia LSANTSIAKNASSNIWLPGWLEAINSGKNSLFLPIGPGDFLVHHAIALALHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFY Porphyra LSSSSNIATQAGSNIWLPGWLEAINSGKNSLFLTIGPGDFLVHHAIALGLHTTALILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFY Arabidopsi LAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIET Nicotiana LAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIET Oryza LAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIET Pinus LAVFWMLNTIGWVTFYWHWKHITLWQGNVAQFNESSTYLMGWSRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIET Marchantia LAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIET Nephroselm LAVFWMLNTIGWTTFYWHWKHLALWQGNAAQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIET Chlorella LAVFWMLNTIGWVTFYFHWKHLGIWQGNVNQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLIYATGFMFLISWRGYWQELIET Chlamydomo LAVFWMLNTIGWVTFYWHWKHLTLWQGNVAQFDESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWTFLFGHLIYATGFMFLISWRGYWQELIET Mesostigma LAVFWMLNTIGWVTFYWHWKHLTLWQGNVAQFDESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLIWATGFMFLISWRGYWQELIET Cyanophora LAVFWMLNTIGWTTFYWHWKHLGVWQGNVAQFNESSTYLMGWFRDYLWLNSSQLINGYNPFGMNNLSVWAWMFLFGHLIWATGFMFLISWRGYWQELIET Cyanidium LGVFWMLNTIGWTTFYWHWKHITIWQGNASQFNESSTYLMGWFRDYLWLNSSPIINGYNPYGMNNLSVWAWMFLFAHLVWATGFMFLISWRGYWQELIES Odontella LAMFWMLNTIGWVTFYWHWKHMTIWGGNPGQFDESSNYIMGWLRDYLWLNSSPLINGYNPFGMNNLSVWAWMFLFGHLIWATGFMFLISWRGYWQELIET Guillardia LSMFWMLNTIGWVTFYWHWKHVTIWQGNAGQFNESSTYIMGWLRDYLWLNSSPLINGYNPFGMNSLSVWAWMFLFGHLIWATGFMFLISWRGYWQELIET Porphyra LAVFWMLNTIGWVTFYWHWKHITIWQGNATQFNESSTYLMGWFRDYLWLNSSPLINGYNPYGMNNLSVWSWMFLFGHLVWATGFMFLISWRGYWQELIET Arabidopsi LAWAHERTPLANLIRWKDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGKFGMIIRSPEPEVKILVDRDPIKTSFEEWAKPGHFSRTIAKGPDTT Nicotiana LAWAHERTPLANLIRWRDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGKFGMIIRSPEPEVKILVDRDPVKTSFEEWARPGHFSRTIAKGPDTT Oryza LAWAHERTPLANLIRWRDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGKFGMMIRSPEPEVKIVVDRDPVKTSFEEWARPGHFSRTLAKGPDTT Pinus LAWAHERTPLANLVRWRDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGKFGMTIRSPEPEVKVVVDRDTVKTSFEKWAKPGHFSRTLAKGPDTT Marchantia LAWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGKFGMTIRSPEPEVKIVVEKDPVKTSFEKWAKPGHFSRTLAKGPSTT Nephroselm LAWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFSVGYVFTYAAFVIASTSGKFGMTISPPEREVKIVVDRNPVVTSFEKWAKPGHFSRTLAKGPTTT Chlorella LAWAHERTPLANLVRWRDKPVALSIVQARLVGLTHFSVGYVLTYAAFLIASTSGKFGMTISPPEREVKIVVDRNPVATNFEKWAKPGHFSRTLSKGPTTT Chlamydomo LVWAHEKTPLANLVYWKDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGRFGMTISTPEREVKIAVDRNPVETSFEKWAKPGHFSRTLSKGPNTT Mesostigma LAWAHERTPLANLVRWKDKPVALSIVQARVVGLAHFSVGYVFTYAAFLIASTSGKFGMTISPPEREGKIVVDRDPVKTSFERWGKPGHFSRSLAKGPNTT Cyanophora LVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFAVGYIVTYAAFLIASTASKFGMRISPPEREVKIVIDKDPVSTSFDKWAVPGHFSRTLAKGPKTT Cyanidium LVWAHERTPLANLITWKDKPVALSIVQARLVGLVHFSVGYVLTYAAFVIASTAGKFNMNQILKEKEAKILVDRNPVPTSFEKWGVPGHFSRSLAKGPKTT Odontella LVWAHERTPLANLIRWRDKPVALSIVQARLVGLVHFAVGYILTYAAFVIASTSGKFAMAISSTERRVQIFVEKDAVETSFAKWAQPGHFSRTLAKGPKTT Guillardia LVWAHERTPLANLVRWRDKPVALSIVQARLVGLVHFTVGYIFTYAAFVIASTAGKFGMTISSTEQEVNVVVDRNPVSTSFEKWGQPGHFSRTLAKGPKTT Porphyra LAWAHERTPLANLIRWKDKPVAMSIVQARLVGLAHFSVGYVLTYAAFVLASTAGKFGMAISSKEQEVKISVDKNPVDTSFEKWAQPGHFSRTLAKGPKTT Arabidopsi TWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQ Nicotiana TWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQ Oryza TWIWNLHADAHDFDSHTGDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQISSGFFQ Pinus TWIWNLHADAHDFDSHTNNLEDISRKIFSAHFGQLAIIFIWLSGMYYHGARFSNYEAWLADPTHIKPSAQIVWPIVGQEILNGDVGGGFRGIQITSGFFQ Marchantia TWIWNLHADAHDFDSHTNDLEEISRKVFSAHFGQLAIIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQ Nephroselm TWIWDLHADAHDFDSHTTDLEDISPKIFSAHFGQLGVILIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQ Chlorella TWIWNLHADAHDFDTQTSDLEEISRKVFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLTDPTHIKPSAQVVWPIVGQEILNADVGGGFQGLQITSGFFQ Chlamydomo TWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQ Mesostigma TWIWNLHADAHDFDSHTNDLEDISRKVFSAHFGQLAVIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGVQITSGFFQ Cyanophora TWIWNLHADVHDFDSYTSDLEDVSRKIFSAHFGHLAVVFIWLSGAYFHGARFSNYEAWLSNPTTIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGLFQ Cyanidium TWIWNLHADVHDFDSHTSSLEDISRKIFSAHFGQLSLIFIWLSGMYFHGARFSNYTIWLSNPSLIKPSAQIVWPIVGQEILNADLGGGSQGIQITSGFFH Odontella TWIWNLHADAHDFDSQTSSLEEVSRKIFSAHFGQLAVIFLWISGMHFHGAYFSNYSAWLSDPISIKQSSQVVWPIVGQEILNADVGGNFQGVQTTSGWFQ Guillardia TWIWNLHADAHDFDSHTSSLEDISRKIFSAHFGQLSIIFLWISGMHFHGARFSNYSAWLSNPTTVKPSAQVVWPIVGQEILNGDVGGGFQGVQVTSGFFQ Porphyra TWIWNLHADAHDFDSQTSSLEEVSRKIFSAHFGQLAVIFLWLSGMYFHGARFSNYVAWLSNPTGIKPSAQVVWPIVGQEILNGDVGGGFQGVQVTSGWFQ Arabidopsi IWRASGITSELQLYCTAIGALVFAALMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLPINQFLNAGVDPKEIPLPHEFILN Nicotiana IWRASGITSELQLYCTAIGALVFAALMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLPINQFLNAGVDPKEIPLPHEFILN Oryza IWRASGITSELQLYCTAIGALIFASLMLFAGWFHYHKAAPKLAWSHDVESMLNHHLAGLLGLGSLSWAGHQIHVSLPINQFLDAGVDPKEIPLPHEFILN Pinus IWRASGITSELQLYCTAIGALIFAALMLFAGWFHYHKAAPKLAWFQEVESMLNHHLAGLLGLGSLSWAGHQIHVSLPINQLLDAGVDPKEIPLPHEFIFN Marchantia LWRASGITSELQLYSTAIGGLVFAALMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLPINQLLDAGVDPKEIPLPHEFILN Nephroselm LWRASGITSELQLYSTAIGGLLLAAAMFFAGWFHYHKAAPKLEWFQNVESMMNHHLGGLLGLGSLGWAGHQIHVSLPVNKLLNAGVDPKEIPLPHEFLLN Chlorella LWRASGITSELQLYTTAIGGLVMAAAMFFAGWFHYHKAAPKLEWFQNVESMLNHHLAGLLGLGSLAWAGHQIHVSLPINKLLDAGVDPKEIPLPHEFLFN Chlamydomo LWRASGITSELQLYTTAIGGLVMAAAMFFAGWFHYHKAAPKLEWFQNVESMLNHHLGGLLGLGSLAWAGHQIHVSLPVNKLLDAGVDPKEIPLPHDLLLN Mesostigma LWRASGIVNEQQLYTTAIGGLIAAGLMFFAGWFHYHKAAPKLEWFQNAESMMNHHLAGLLGLGSLSWAGHQIHVSLPVNQLLDAGVDPKEIPLPHEFVMN Cyanophora MWRASGITTELQLYVTAIGALVMAALMLFAGWFHYHKAAPKLEWFQNAESMMNHHLAGLFGLGSLSWAGHQIHVSLPVNKLLDSGVSPQEIPLPHEFILN Cyanidium LWRASGITNELELYVTALGGLFMAGLMAFGGWFHYHKAAPKLEWFQNVESMLNHHLAGLLGLGSLSWAGHQIHVSLPINKLLDAGVDPKTIPLPHEFILN Odontella MWRAEGITSEVELYWIAIGGLIMSALMLFAGWFHYHKAAPKLEWFQNAESMMNHHLAGLLGLGCLSWSGHQIHIALPINKLLDAGVAPQEIPLPHEFLIN Guillardia IWRAEGITSEVELYWCAVAGLLMSGLMIFAGWFHYHKAAPKLEWFQNAESMLNHHLSGLLGLGCLSWAGHQIHVGLPINKLLDAGVAPQEIPLPHEFLMN Porphyra LWRASGITTEFQLYCTAIGGLGMAALMLFAGWFHYHKAAPKLEWFQNVESMMNHHLAGLLGLGCLGWAGHQIHLSLPINKLLDSGVSPQEIPLPHEFLIN Arabidopsi RDLLAQLYPSFAEGATPFFTLNWSKYSEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRTNWGIGHGIKDILEAHKGPFTGQGHKGLYEILT Nicotiana RDLLAQLYPSFAEGATPFFTLNWSKYADFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRTNWGIGHGLKDILEAHKGPFTGQGHKGLYEILT Oryza RDLLAQLYPSFAERATPFFTLNWSKYAEFLSFRGGLDPITGGLWLSDIAHHHLAIAILFLIAGHMYRTNWGIGHGLKDILEAHKGPFTGQRHKGLYEILT Pinus RDLLAQLYPSFAKGVTPFLTLNWSEYSDFLTFRGGLNPVTGGLWLTDTAHHHLAIAVLFLIAGHMYKTNWRIGHNLKDLLEAHKGPFTGEGHKGLYEILT Marchantia RDLLAELYPSFAKGLTPFFTLNWSEYSDFLTFRGGLNPVTGGLWLTDTAHHHLAIAVLFLVAGHMYRTNWGIGHSFKEILEAHKGPFTGEGHKGLYEILT Nephroselm RDLMAQLYPSFAKGLTPFFTLNWAEYGDFLTFRGGLNPVTGGLWLSDTAHHHVAIAVLFLVAGHMYRTNWGIGHSMKEILEAHKGPFTGEGHKGLYEILT Chlorella PELMAQLYPSFAKGLAPFFTLDWAQYSDFLTFQGGLNPVTGGLWLTDTVHHHLAIAVLFLVAGHQYRTNWGIGSSLKEILEAHKGPFTGEGHKGLYEILT Chlamydomo RAIMADLYPSFAKGIAPFFTLNWSEYSDFLTFKGGLNPVTGGLWLSDTAHHHVAIAVLFLVAGHMYRTNWGIGHSMKEILEAHRGPFTGEGHVGLYEILT Mesostigma RELMAQLYPSFAKGLAPFFTLNWGEYSDFLTFRGGLNPVTGGLWLTDTVHHHVAIAVLFIVAGHMYRTNWGIGHSMKEILEAHKGPFTGEGHKGLYEILT Cyanophora KDLIAQLYPSFGQGLTPFFTLNWNEYSDFLTFKGGLNPVTGGLWLSDRAHHHLAIAVLFIVAGHMYRTNWGIGHSMKEMLETHKGPFTGEGHKGLYEIFT Cyanidium RELMSQLYPSFEKGLWPFFSLNWGAYSDFLTFRGGLNPITGSLWMSDIAHHHLAISVLFIVAGHMYRTNWGIGHSIKEILDAHRGPLTGSGHRGLYEALT Odontella RELMAQLYPSFNKGLAPFFSGQWGEYSDFLTFKGGLNPVTGGLWLSDIAHHHLALSVLFIFAGHMYRTNWGIGHSMKEILEAHKGPFTGEGHKGLYEILT Guillardia RDLMAQLYPSFNKGLIPFFSLNWSEYSDFLTFKGGLNPVTGGLWLSDTAHHHLALAVLFIVAGHMYRTNWGIGHSMKEILEAHKGPFTGEGHKGLYEILI Porphyra RELMAQLYPSFSKGLVPFFTLNWAEYSDFLTFKGGLNPVTGGLWLSDTAHHHLALAVLFLAAGHMYRTNWGIGHSMKEILEAHKGPFTGNGHEGLYEILT Arabidopsi TSWHAQLSLNLAMLGSLTIIVAHHMYSMPPYPYLATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTNRYNDLLDRVLRHRDAIISHLNWVCI Nicotiana TSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYLATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWACI Oryza TSWHAQLSLNLAMLGSTTIVVAHHMYSMPPYPYLATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWVCI Pinus TSWHAQLAVNLAMLGSLTIVVAHHMYSMPPYPYLATDYGTQLSLFTHHMWIGGFIIVGAAAHAAIFMVRDYDPTTQYNNLLDRVLRHRDAIVSHLNWVCI Marchantia TSWHAQLALNLAMLGSLTIIVAHHMYAMPPYPYLATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTQYNNLLDRVLRHRDAIISHLNWVCI Nephroselm TSWHAQLAINLALFGSLSIVVAHHMYAMPPYPYLATDYGTQLSLFTHHMWIGGFCVVGAAAHAAIFMVRDYDPTNNYNNLLDRVIRHRDAIISHLNWVCI Chlorella TSWHAQLAINLALFGSLSIIVSHHMYAMPPYPYLATDYGTQLSLFTHHMWIGGFCIVGAGAHAGIFMVRDYDPTNNYNNLLDRVLRHRDAMISHLNWVCI Chlamydomo TSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYLATDYGTQLSLFTHHTWIGGFCIVGAGAHAAIFMVRDYDPTNNYNNLLDRVIRHRDAIISHLNWVCI Mesostigma TSWHAQLGLNLALMGSLSIIVAHHMYAMPPYPYLATDYGTQLSLFTHHMWIGGFCIVGGAAHAAIFMVRDYDPTNNYNNLLDRVIRHRDAIISHLNWVCI Cyanophora NSWHAQLSLNLALFGSLSIIVAHHMYSMPPYPYLATDYATSLCLFTHHVWIGGFLIVGAGAHAAIFMVRDYDPAQNYNNLLDRVLRHRDAIISHLNWVCI Cyanidium TSWHANLAINLALFGSLSIIVAHHMYAMPPYPYISIDYPTQLSLFTHHTWIGGFCIVGASAHGAIFMIRDYVPSQHYNNVLDRLIRHRDALISHLNWVCI Odontella TSWHAQLAINLAMMGSLSIIVAHHMYAMPPYPYIATDYATQLSLFTHHMWIGGFCVVGGAAHGAIFMVRDYTPANNYNNLLDRVLRHRDAIISHLNWVCI Guillardia TSWHSQLAINLAMMGSLSIIVAHHMYAMPAYPFIATDYPTQLSIFTHHMWIGGFCICGAAAHAGIFMVRDYNPAQNYNNLLDRVIRHRDAIISHLNWICI Porphyra TSWHAQLAINLAMMGSLSIIVAHHMYAMPPYPYIATDYPTQLSLFTHHMWIGGFCVVGAGAHASIFMVRDYNPAENYNNLLDRIIRHRDAIVSHLNWVCI Arabidopsi FLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHALAPGVTAPGETASTSLTWGGELVAVGGKVALLPIPLGTADFLVHHIHAFTIHVT Nicotiana FLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHALAPGATAPGATASTSLTWGGDLVAVGGKVALLPIPLGTADFLVHHIHAFTIHVT Oryza FLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNLHAGAPRLTAPGATTSTSLTWGGELVAVGGKVALLPIPLGTADFLVHHIHAFTIHVT Pinus FLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWIQNTHASAPGSTAPGATASTSLTWGGDLVTVGSKVALLPIPLGTADFLVHHIHAFTIHVT Marchantia FLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHALAPNFTAPNALASTSLTWGGDVIAVGSKVALLPIPLGTADFLVHHIHAFTIHVT Nephroselm FLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIHKTHALAPGLTAPNALASTSPSWGGDGVAVGGKVAMMPISLGTADFLVHHIHAFTIHVT Chlorella FLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWVQNTHFLAPGFTAPNALASTSPSWGGDVVAVGGKVAMMPISLGTADFMVHHIHAFTIHVT Chlamydomo FLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHFLAPQLTAPNALAATSLTWGGELGAHGGKVAMMPISLGTSDFMVHHIHAFTIHVT Mesostigma FLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQFVQNRNYLAPGFSAPNALASSSAVWGGDVVAVGGKVAMMPIQLGTSDFLVHHIHAFTIHVT Cyanophora FLGFHSFGLYIHNDTMRALGRPQDMFSDAAIQLQPVFAQWVQGVNSAAAGNTAPNALRNASYAFGGDIVSVGEKVAMMPISLGTADFLVHHIHAFTIHVT Cyanidium FLGTHSFGLYIHNDTMRALGRSQDMFSDTAIQLQPIFAQWIQSLHTLAPANTAPNALATTSYVFGGEVVAVANKIAMMPMKLGTADFMVHHIHAFTIHVT Odontella FLGCHSFGLYIHNDTMRALGRPQDMFSDKAIQLQPIFAQWVQNIHLLAPGTTAPNALATTSYAFGGDVVEVGGKIAMMPIKLGTADFMVHHIHAFTIHVT Guillardia FLGFHSFGLYIHNDTMRALGRTQDMFSDTAIQLKPVFAQWVQNIHTIAPGNTTPNALATASYAFGGDVISVGNKVAMMPISLGTADFMVHHIHAFTIHVT Porphyra FLGFHSFGLYIHNDTMRALGRSQDMFSDTAIQLQPIFAQWVQSIHTLAPGNTAPNALATASYAFGGEVVSVGNKVAMMPISLGTADFMVHHIHAFTIHVT Arabidopsi VLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNAISVVIFHFSWKMQSDVWGSISDQGVTHITGGNFAQSSITINGWL Nicotiana ALILLKGVLFARSSRLTPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNAISVVIFHFSWKMQSDVWGSVSDQGVTHITGGNFAQSSITINGWL Oryza VLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISVVIFHFSWKMQSDVWGTISDQGVTHITGGNFAQSSITINGWL Pinus VLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNAISVVIFHFSWKMQSDVWGNISDQGVTHITGGNFAQSSITINGWL Marchantia VLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISVVIFHFSWKMQSDVWGTISEQGVTHITGGNFAQSAITINGWL Nephroselm VLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISVVIFHFSWKMQSDVWGNVTAQGVSHITGGNFALSSNTINGWL Chlorella VLILLKGVLYARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISIVIFHFSWKMQSDVWGTVSANGVSHITGGNFAQSANTINGWL Chlamydomo VLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVTASGVSHITGGNFAQSANTINGWL Mesostigma VLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNCLSIVIFHFSWKMQSDVWGSVTAQGVSHITGGNFAQSANTINGWL Cyanophora VLILLKGVLFARNSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSVVLFHFSWKMQSDVWGNVTADGVSHITGNNFAQSSITINGWL Cyanidium LLILLKGVLFARNSRLIPDKANLGFRFPCDGPGRGGTCQVSSWDHVFLGLFWMYNCISVVIFHFSWKMQSDVWGTVSQNSVSHVVGGNFSQSAITINGWL Odontella VLILLKGVLYARSSKLIPDKANLGFRFPCDGPGRGGTCQSSSWDHVFLGLFWMYNSISVVIFHFSWKMQSDVWGTITPDGISHITGGNFAQSSITINGWL Guillardia VLILLKGVLFSRNSRLIPDKANLGFRFPCDGPGRGGTCQSSAWDSVFLGLFWMYNCISVVIFHFSWKMQSDVWGTVQNDGVTHITGGNFAQSSITINGWL Porphyra VLILVKGFLFSRNSRLIPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSVAIFHFSWKMQSDVWGSVSPSGVSHITGGNFAQSAITINGWL Arabidopsi RDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLAR Nicotiana RDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLAR Oryza RDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLAR Pinus RDFLWAQASQVIQSYGSSLSAYGLLFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSIVQGRAVGVAHYLLGGIVTTWAFFLAR Marchantia RDFLWAQASQVIQSYGSSLSAYGLLFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWAFFLAR Nephroselm RDFLWAQASQVIQSYGSALSAYGLIFLGAHFIWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPSIQPRALSITQGRAVGVAHYLLGGIATTWAFFLAR Chlorella RDFLWAQSSQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLAR Chlamydomo RDFLWAQSSQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLAR Mesostigma RDFLWAQASQVIQSYGSALSAYGLMFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWAFFLAR Cyanophora RDFLWAQASQVIQSYGSALSAYGLMFLGAHFIWAFSLMFLFSGRGYWQELIESIVWAHNKLKFAPSIQPRALSITQGRAVGVAHYLLGGIATTWSFFHAR Cyanidium RDFLWAQASQVIQSYGSSISAYGLMFLAAHFIWAFSLMFLFSGRGYWQELIESIVWAHSKLKIAPTIQPRALSITQGRAVGAAHYLLGGIATTWAFFLSR Odontella RDFLWSQASQVIQSYGSASSAYGLIFLGAHFIWAFSLMFLFSGRGYWQELIESIVWAHNKLNFAPAIQPRALSITQGRAVGLAHYLLGGIGTTWSFFLAR Guillardia RDFLWAEASQVIQSYGSALSAYGLIFLGAHFIWAFSLMFLFSGRGYWQELIESIVWAHNKLHFAPAIQPRALSITQGRAVGLAHYLLGGIGTTWAFFLAR Porphyra RDFLWAQASQVIQSYGSALSAYGLIFLAAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKIKVAPAIQPRALSITQGRAVGVAHYLLGGIGTTWAFFLAR Arabidopsi IIAVGMSRYRGPRFKKIRRLGALPGLTSKRPKQYRIRLEEKQKLRFHYGLTEHQLLKYVRIAGKAKGSTGQVLLQLLEMRLDNILFRLGMALTIPQARQL Nicotiana IIAVGMSRYRGPRFKKIRRLGALPGLTNKKPRQYRIRLEEKQKLRFHYGLTERQLLKYVRIARKAKGSTGQVLLQLLEMRLDNILFRLGMASTIPAARQL Oryza IIAVGMSRYRGPRFKKIRRLGALPGLTRKTPKQYRIRLQEKQKLRFHYGLTERQLLRYVHIAGKAKSSTGQVLLQLLEMRLDNILFRLGMASTIPEARQL Pinus IIAIGMSRYRGPRLKIIRRLKTLPGLTSKRPKQYRIRLEEKQKLRFHYGLTERQLLKYVRIARRAKGSTGQVLLQLLEMRLDNILFRLGMAPTIPGARQL Marchantia IIAVGMSRYRGPRVKIIRRLGALPGLTNKTLKQYRIRLEEKQKLRFHYGLTERQLLKYVRIARKAKGSTGQVLLQLLEMRLDNIIFRLGMAPTIPGARQL Nephroselm IIAVGMSRYRGPRLKIVRRLGELPGLTRKMAKQYRIRLEEKQKLRYNYGVTEKQLLRYMQRARRAKGSSGENLLQLLEMRLDTTIFRLGMAPTMLSARQL Chlorella ILAVGMARYRGPKLRIVRRLGELPGLTQKNCTQYAVRLKEKQKLRFNYGISERQLMSYVREARKRKGSTGEILLQILEMRLDTIIFRLGFAPTIAAARQL Chlamydomo IISVGMSRYLGPRLRVIRRIGKLRGFTRKKPFDYLIRLKVKQRLRFNYGITERQLVNYVRKAKKIKESTGQVLLQFLEMRLDNIVFRLNMAPTIPAARQL Mesostigma IIAVGMSRYRGPRLKIVRKLGDLPGLTSKINKQYGIRLQEKQKLKYNYGVTEKQLLLYIRKARTIKGSTGQMLLQYLEMRLDNTVFRLGLAPTIAGARQL Cyanophora IISVGMSRYKGPSLRIIRRLGELPGLTRKVVKEYAIRLEEKQKLRYNYGLTERQLVQCVRRAKQMKGSTGQILLQLLEMRLDNIVFRLGMAPTIPASRQL Cyanidium AISIGMSRYTGPKIRIIRRLGELPALTTKKVKEYAIRLQEKQKIRFNYGINEKQLRRYVKKAKKSRGSTGSYLLNLLEMRLDNIVLRAGLAPTIAASRQL Odontella AISITMSRYRGPKLRITRRLGALPGLTQKQSKEYGIRLEEKQKLKFNYGLTESQLYRYIKEARRRKGVTGLILLQLLEMRLDTICFTLGFAPTIASARQL Guillardia IISVGMSRYRGAVIKIIRRLGELPGLTRKTTTEYAIRLEEKQKLRFNYGLTEKQLLQYVRTAKRIKGSTGEALLQLLEMRLDNVIFRLGMAPTIPAARQL Porphyra IISVGMSRYRGPRVRISRRLGDLPGLSRKAIKEYAVRLEEKQKLRFNYGLSEKQLFKYVKAAKKLQGSTGQILLQLLEMRLDNTIFRLGMAPTIPAARQL Arabidopsi VNHGHILVNGRIVDIPSYRCKPRDIITVKDEQNSLVQNLLDMLNLCVLTPNRIVWDSEVKEIILSTNSGQIGVLANHAPIATAVDIGILKIRNQWLTMAL Nicotiana VNHRHILVNGRIVDIPSYRCKPRDIITAKDEQKSLIQISLDMLNLSVLTPNRIVWDSEVEEIVLSTNSGQIGILPNHAPIATAVDIGILRIRDQWLTMAL Oryza VNHRHILVNGRIVDIPSFRCKPRDIITTKDNQRSLVQNSIAMLNLYVLTPKRIIWDCEVKEIILSTNSGQIGVLPNHAPINTAVDMGPLRIRDQWLTAVL Pinus VNHGHIRVNDHMVDIPSYPCKPQDVITIRDQQRLIIKKNIDMLNLRVLSPNRVIWDSEVKEIILSTNSGQIGVLPNHASLVAAVDIGVMKIRGQWSTMAM Marchantia VNHRHILINNNTVDIPSYNCKPKDVITIKDRSKSIIIKNLNMLNLRIMAPNRIVWNSDIQEIILSTNSGQIGILPNHASVLTALDIGIVKIRDQWSTMAL Nephroselm ITHGHILVSEQRVNIPSYQCSPKEKISIRSNSRSLIEGYMSMLQVRILTPEQVFLNVSADEIILPTNTGQMGVLTNHTPLITAIDIGPMLVRSTWQSMAL Chlorella INHGHIVVNGRRVDIPSSLCKVNDSISVALNSQNFVKNLLQMLQVCIMTPDRIFWNDQADEIILPTNTGQMGVLTNHAPLITALDIGVTLIRSNWNPVAL Chlamydomo ISHGHIRVNNKKVNIPSYMCKPKDVISVAMKQRSLVNKNLQMLQISILTPERPFWNGQADEIILPTETGEMGVLKNHAPIITGLDVGAMLIRDEWNSYAI Mesostigma VNHGHIMVNNRIVTIPSYKCKPKDILSIRNNNKSLVLNNLAMFQVRIIAPNGIIWDSEAEEIILSTNTGKIGVLTNHTSLLTGLDIGTIRIRNQWNTLAL Cyanophora VNHGHICVNNKVVSIPSYQCKPGDIITVKERNASIVETNLLMLDVRVIAPNKVIWAKNAEEVILPSQSGMLGILTSHAPLYTALNTGVMKIRTGWTSIVV Cyanidium VSHKHIEVNNKIVNIPSFQCSIGDTIHVKKSNKSLIDLNSRMLTVKVITPDRVVWKKTVEEIILPSSTGQLGILMNHAPLLTALDIGVMRARNTWVPLVL Odontella VNHGHITVNDNVVSIPSFQCQINDVIGIKPKATSLVEGNLQMMNVRVLTPTRVICSTTADEVILPGLTGLVGILDGHAALITALDTGLLRIKEKWTPIIL Guillardia VNHGHIKVNNTRVSIPSYQCKAGDMISIRQHPKSIVKNYLQMIHISIIAPDRTVWDANAEEVILPSSTGQLGILKGHAPLLTALDIGVMRVRRDWTPIVL Porphyra VNHGHICINGKVVSICSYQCKPGELITVKPQESSLVESYLAMLNIRIIAPDRTVWDAEAQEIILPSSTGQLGILTGHAPLLTALDIGVMRVRKEWMPIVL Arabidopsi MGGFARIGNNEITILVNDAEKNSDIDPQEAQQTLEIAEANLRKAEGKRQTIEANLALRRARTRVEALNKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVV Nicotiana MGGFARIGNNEITVLVNDAEKGSDIDPQEAQQTLELAEANVKKAEGRRQKIEANLALRRARTRVEAINKNPGRVVQIIGPVLDVAFPPGKMPNIYNALVV Oryza WSGFARIVNNEIIILGNDAELGSDIDPEEAQQALEIAEANVSRAEGTKELVEAKVALRRARIRVEAVNKSTGRIDQIIGPVLDVTFPRGKLPYIYNALVV Pinus MGGFAKIDSDRITILVNNAERDVDIDPREAQENFRIAKADLARAEGKRQAIEADLALKRARTRLEAINTNVGRIAQIIGPVLDVSFPPGNMPNIYNSLIV Marchantia MGGFAMIDNNNLTILVNDAEKASEIDYQEAQETFQKAKTNLEEAEGNKKEIEALLVFKRAKARLEAINKNIGSITQVIGPVLDVAFSPGKMPNIYNSLIV Nephroselm LGGLALVKDNQVIILVNEAELGSDINAEEAETTFLAAKEALANSKTRKDQIENNLAFKRARVRYQVATKQAGKIVQIVGPVMDVAFQPGSMPNIYNALIV Chlorella MGGFALVKQNQVTILVNEAESAQTIGVDEAEIAFQEAKTKLEQSQGEKQRVEATFVFKRARARYQVVKKSSGRITQIIGPVLDVSFPAGKMPNIYNALTV Chlamydomo MGGFALVKQNQVTILANEAVSAENINPEEAKDAFETAKANLEKAEGVKEKVEANFAYKRAKARYQVVKKNMGRIVQIIGPVLDIVFAKGQVPNIYNALTI Mesostigma MSGFAVIKDNVATIIVSEAENGANIKSEEAQTQLEEAKSYFNTAKGTKNEVEANLAVKRAETRLKASQKRIGSITQIIGPVLDAKFPPGQMPNIYNALIV Cyanophora MGGFVEVEKNEVLVLVNAGEYVDEIDLSAAKKDVEKALETFNSAEAPKEKEEAAEFLKYAQARLKAVVTNTGYVTQVIGPVLDVSFPNGQLPKIYNAITV Cyanidium LGGFAQIDNNLVTIIVSDAEEVKAIDEEEANKLLAASLANMEKAQSNREKIESMQNLRRARARMQAILNNKGKVIQIIGPVLDIVFPDGQLPKVFNAIKI Odontella CGGLAEIDRNRVTVLVNDVEELVAVELNEATTELEKATLAVENAETSKARLDASIELKKAVARLEGMNINKGYVNQIIGPVLDIEFPSGTLPPIYSALKI Guillardia LGGFAEIENDELTILVNGAEEASQIDRDQAQRDLEEMTVKFNEATTNKERIEATQNLRKARARLQAVSTNIGYITQIIGPVVDVEFTTGKLPQIYNAIII Porphyra LGGFAEIENNQLTILVNGAEEASQIDLVEAEKNLDTATQLLNDASSSKEKIEATQNIRKARARVQAATKSTGSVTQIIGPVLDIAFPNGQLPKVFNALKV Arabidopsi KGRDTNVTCEVQQLLGNNRVRAVAMSATEGLKRGMDVVDMGNPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIELDTKLSIFETGIK Nicotiana QGRDSNVACEVQQLLGNNRVRAIAMSATEGLTRGMEVIDTGAPISVPVGGATLGRIFNVLGEPVDNLGPVDTSTTSPIHRSAPAFIQLDTKLSIFETGIE Oryza KSRDTNVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTSATFPIHRSAPAFIELDTKLSIFETGIK Pinus KGQGTQVTCEVQQLLGNHKVRAVAMSATDGLTRGMRVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDAGITSPIHRPAPAFTELDTKLSIFETGIK Marchantia KDQNSNVTCEVQQLLGNNKVRAVAMSATDGMMRGMKVIDTGAPLTVPVGEATLGRIFNVLGEPVDNLGPVEVTTTFPIHRAAPAFTQLDTKLSIFETGIK Nephroselm KGRNGSVVCEVQQLLGDGLVRAVSMSATDGLMRGMEVTDTGRALSVPVGPTTLGRIFNVLGEPVDNMGPVGNEKTLPIHREAPAFVDLDTKLSIFETGIK Chlorella GGKNESVTCEVQQLLGDHCVRAVAMSATDGLMRGMEVLDSGKPLNVPVGAATLGRIFNVLGEPVDNLGPVNTKDQLPIHRSAPAFVDLDTKLSIFESGIK Chlamydomo RAKNSAVTCEVQQLLGDNCVRAVSMNPTEGLMRGMEVVDTGKPLSVPVGKVTLGRIFNVLGEPVDNMGNVKVEETLPIHRTAPAFVDLDTRLSIFETGIK Mesostigma KAKNESVTCEVQQLLGDNQVRAVAMSATDGLMRGLEILDTGAPLSVPVGEITLGRIFNVLGEPVDGLGDVVAKTKSPIHRNSPTFIELDTKLSIFETGIK Cyanophora KGKNETVTCEVQQLLGDNQVRAVSMSTTDGILRGMEVTDSGAAISVPVGTPTLGRIFNVLGEPVDELGAVVCDSTLPIHRPSPAFTQLETKSSIFETGIK Cyanidium NNSNNWITCEVQQLLGDNKVRAVAMSTTEGLKRGASAIDTGEPISIPVGKETLGRIFNVLGEPIDEKGPVISNDKLPIHRPAPKFTQLETKPSIFETGIK Odontella ETEDGGTVVEVQQLLGDNKVRAVSMRSTDGLKRGVEARDLGGPISVPVGISTLGRIFNVIGEPVDEQGDVSYDETLPIHREAPAFTELETKPSIFETGIK Guillardia GSGENAVTCEVQQLLGNNKVRAVSMTSTDGLKRGMEVTDTQAPISVPVGKATLGRIFNVLGQPVDNMGDVALDQTLPIHRGSPAFTQLETKPSIFETGIK Porphyra QSTDGTITCEVQQLLGDNKVRAVSMSSTEGLKRGVEVVDTGAPISVPVGTNTLGRIFNVLGEPVDNLGPVSSESTLPIHRPAPAFTKLETKPSIFETGIK Arabidopsi VVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNLAESKVALVYGQMNEPPGARMRVGLTAL Nicotiana VVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTAL Oryza VVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEKNLEESKVALVYGQMNEPPGARMRVGLTAL Pinus VVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVIDEQKISESKVALVYGQMNEPPGARMRVGLTAL Marchantia VVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNILKAHGGVSVFGGVGERTREGNDLYMEMKESKVINEQNISESKVALVYGQMNEPPGARMRVGLTAL Nephroselm VVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMCESKVINKADVKSSKVALVYGQMNEPPGARMRVGLTAL Chlorella VVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINESNISESKVALVYGQMNEPPGARMRVGLTAL Chlamydomo VVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFAGVGERTREGNDLYTEMKESGVIVEKNLSDSKVALVYGQMNEPPGARMRVALTAL Mesostigma VVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESKVINEENLSSSKVALVYGQMNEPPGARMRVGLTAL Cyanophora VVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYQEMKESKVIDENNLPASKVALVYGQMNEPPGARMRVALTAL Cyanidium VVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGVSVFGGVGERTREGNDLYQEMKESGVINEKDLNLSKVALCYGQMNEPPGARMRVGLTAL Odontella VVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYEEMKESGVINENNFKESKVALVYGQMNEPPGARMRVGLTAL Guillardia VVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESKVINESNLGESKVALVYGQMNEPPGARMRVGLTAL Porphyra VVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESKVINEDNLKESKVALVYGQMNEPPGARMRVGLTAL Arabidopsi TMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR Nicotiana TMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR Oryza TMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR Pinus TMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHSDATTVLSR Marchantia TMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR Nephroselm TMAEYFRDVNNQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR Chlorella TMAEFFRDINKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR Chlamydomo TMAEYFRDVNKQDVLFFIDNIFRFVQAGAEVSALLGRMPSAVGYQPTLATEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR Mesostigma TMAEYFRDVNNQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSREMGTLQERITSTKQGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR Cyanophora TMAEYFRDVNNQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTEMGSLQERITSTTKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR Cyanidium TMAEYFRDVNKQNVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTEMGALQERITSTLDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR Odontella TMAEYFRDVNKQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTTQGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR Guillardia TMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGSLQERITSTTEGSITSIQAVYVPADDLTDPAPATTFSHLDATTVLSR Porphyra TMAEYFRDINKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTTEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR Arabidopsi GLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQQVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAET Nicotiana GLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLLVARARKIERFLSQPFFVAEVFTGSPGKYVGLAET Oryza GLASKGIYPAVDPLDSTSTMLQPRIVGNEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAET Pinus GLAAKGIYPAVDPLDSTSTMLQPWIVGEEHYETAQGVKQTLQRYKELQDIIAIPGLDELSEEDRLIVARARKIERFLSQPFFVAEVFTGSPGKYVGLMET Marchantia GLAAKGIYPAVDPLDSTSTMLQPWIVGEEHYETAQGVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVSLRET Nephroselm NLAAKGIYPAVDPLDSTSTMLQPWILGDDHYGTAQRVKQTLQRYKELQDIIAILGLDELSEEDRMIVARARKIERFLSQPFFVAEVFTGAPGKYVPLAES Chlorella NLASKGIYPAVDPLDSTSTMLQPWIVGDQHYQCAQNVKQTLQRYKELQDIIAILGLDELSEEDRLIVARARKIERFLSQPFFVAEVFTGSPGKYVSLAET Chlamydomo NLAAKGIYPAVDPLESTSTMLQPWILGEKHYDSAQSVKKTLQRYKELQDIIAILGLDELSEEDRLIVARARKIERFLSQPFFVAEVFTGSPGKYVSLAET Mesostigma NLAAKGIYPAVDPLDSTSTMLQPWIVGEEHYGTAQRVKQTLQRYKELQDIIAILGLDELSEEDRLVVARARKIERFLSQPFFVAEVFTGSPGKYVSLADS Cyanophora NLAAKGIYPAVDPLDSTSTMLQPGIVGEKHYACAQRVKGILQRYKELQDIISILGLDELSEDDRLAVARARRVERFLSQPFFVAEVFTGSPGKYVSLEDT Cyanidium ALAAKGIYPAVDPLDSTSTMLQPGIVSDEHYTTARKVKETLQRYKELQDIIAILGLDELSEEDRLIVSRARKIEKFLSQPFFVAEVFTGISGKYVSLSDS Odontella NLAAKGIYPAVDPLDSTSTMLQPGIVSGEHYEIAETVKETLQRYKELQDIIAILGIDELSEEDRLTVARARKVERFLSQPFFVAEIFTGSPGKYVSLEET Guillardia NLAAKGIYPAVDPLDSTSTMLQINIVGQEHYSCAQNVKETLQRYKELQDIIAILGLDELSEEDRQIVARARKIERFLSQPFFVAEVFTGSPGKYVSLADT Porphyra NLAAKGIYPAVDPLDSTSTMLQPGIVGTDHYSTAQEVKSTLQRYKELQDIIAILGLDELSEEDRQTVSRARKIERFLSQPFFVAEVFTGSPGKYVSLEDA Arabidopsi IRGFNLILSGEFDSLPEQAFYLVGNIDEATAKATMSPQTETKASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTW Nicotiana IRGFQLILSGELDGLPEQAFYLVGNIDEATAKAMMSPQTETKASVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTW Oryza IRGFQLILSGELDGLPEQAFYLVGNIDEASTKAIMSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTW Pinus IRGFQMILSGELDGLIEQSFYLVGNIDEATAKAIMSPKTETKASVGFKAGVKDYRLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTW Marchantia IKGFQMILSGELDSLPEQAFYLVGNIDEATAKAAMSPQTETKAGVGFKAGVKDYRLTYYTPDYETKDTDILAAFRMTPQPGVPAEEAGNAVAAESSTGTW Nephroselm IQGFKLILSGELDSLPESAFYLVGNIEEAIAKAAMAPQTETQAKAGFKAGVKDYRLTYYTPDYQVKDTDILAAFRMTPQPGVPPEECGAAVAAESSTGTW Chlorella IQGFNLILSGELDDLPEQAFYLVGNLDEAVSKAAMSPQTETKARVGFKAGVKDYRLTYYTPDYQPKDTDILAAFRMTPQPGVPPEEAGAAVAAESSTGTW Chlamydomo IEGFGKIFAGELDDLPEQAFYLVGNITEAISKAAMVPQTETKAGAGFKAGVKDYRLTYYTPDYVVRDTDILAAFRMTPQLGVPPEECGAAVAAESSTGTW Mesostigma IKGFTMILNGELDSLPEQAFYLVGNIEEAIAKAAMSPKTETKAGTGFKAGVKDYKLTYYTPDYVVKDTDILAAFRMTPQPGVPPEECGAAVAAESSTGTW Cyanophora IKGFTMILDGELDELPEQSFYLVGDIQEAISKGQMSSQARTQTRAGFKAGVKDYRLTYYTPEYTPKETDILAAFRMTPQPGVPPEECAAAVAAESSTGTW Cyanidium IKGFNMILSGEVDNIPEQAFYLVGRIEEAIDKAKMAQSVQERTRLKYESGVIPYKMGYWDPNYVVKDTDILALFRVTPQPGVDPIEASAAVAGESSTATW Odontella IKGFTMVLKGELDELPEQAFYLVGNIDEAIAKAEMSQSVSERTRIKYESGVIPYKMGYWDASYTVQDTDVLALFRITPQPGVDPVEAAAAVAGESSTATW Guillardia MKGFNMILNGELDELPEQSFYLVGNIDEAIEKAKMSQSVESRTRIKYESGVIPYKMGYWDADYVIKDTDVLAMFRMTPQKGVDPVECAAAIAGESSTATW Porphyra IKGFQMILKGELDDLPEQAFYLVGDIDEAIQKADMSQSVESRTRIKYESGVIPYKMGYWDADYVIKETDILALFRITPQPGVDPIEASAAIAGESSTATW Arabidopsi TTVWTDGLTSLDRYKGRCYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDKLNKYG Nicotiana TTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYG Oryza TTVWTDGLTSLDRYKGRCYHIEPVVGEDNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPTYSKTFQGPPHGIQVERDKLNKYG Pinus TTVWTDGLTSLDRYKGRCYDIEPVPGEETQFIAYVAYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPSYSKTFQGPPHGIQVERDKLNKYG Marchantia TTVWTDGLTNLDRYKGRCYDIDPVPGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYTKTFQGPPHGIQVERDKLNKYG Nephroselm TTVWTDGLTSLDRYKGRCYDLEPVAGEDNQYIAYVAYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRISVAYCKTFQGAPHGIQVERDKLNKYG Chlorella TTVWTDGLTSLDRYKGRCYDIEPVPGEENQYIAYIAYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYG Chlamydomo TTVWTDGLTSLDRYKGRCYDIEPVPGEDNQYIAYVAYPIDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFVGPPHGIQVERDKLNKYG Mesostigma TTVWTDGLTSLDRYKGRCYDLEPVAGEENQYIAYVAYPIDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYG Cyanophora TTVWTDGLTSLDRYKGRSYGFEPVPGEENQYICYVAYPLDLFEEGSVTNMLTSIVGNVFGFKALRALRLEDLRIPVGYSKTFQGPPHGITVERDKLNKYG Cyanidium TVIWCDLLTACDVYRAKAYRVDQVPNSPDQYFAYIAYDLDLFEEGSIANLTASIIGNVFGFKALAALRLEDMRIPIGYLKTFQGPATGVVVERERLNMFG Odontella TVVWTDLLTACERYRAKAYRVDPVPNTTDQYFAFIAYECDLFEEGSLANLTASIIGNVFGFKAVAALRLEDMRIPYAYLKTFQGPATGIVVERERLNKYG Guillardia TVVWTDLLTACDLYRAKAYRVDPVPGATDQYFAYIAYELDLFEEGSLANLTASIIGNVFGFKAVNALRLEDMRLPIAYLKTFQGPATGVIVERERLDKYG Porphyra TVVWTDLLTACDLYRAKAYRVDPVPNVADQYFAYIAYDIDLFEEGSIANLTASIIGNVFGFKAVKALRLEDMRMPVAYLKTFQGPATGLIVERERMDKFG Arabidopsi RPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVM Nicotiana RPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVM Oryza RPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFCAEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVM Pinus RPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFVFCAEALNKAQAETGEIKGHYLNATAGTCEEMMKRAIFARELGVPIVM Marchantia RPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFVAEAIYKSQAETGEIKGHYLNATAGTCEEMLKRAACARELGVPIVM Nephroselm RGLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKAQAETGEIKGHYLNATAGTSEEMLKRAVFAKELGVPIIM Chlorella RGLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFVAEAIYKSQAETGEIKGHYLNATAATAEAMMQRAECAKDLGVPIIM Chlamydomo RGLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFVAEAIYKAQAETGEVKGHYLNATAGTCEEMMKRAVCAKELGVPIIM Mesostigma RPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFLFVAEAIFKSQSETGEIKGHYLNATAATCEEMLKRAAYAKELGVPIIM Cyanophora RALLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLYVMDAIKKSQAETGEIKGHYLNATAPTTEEMIKRAEFAAELDAPIIM Cyanidium KPFLGATVKPKLGLSSKNYGRVVYEGLKGGLNFLKDDENINSQPFMRWRERFLYVMEGVNRASAATGEIKGSYLNVTAATMEEMYNRAACAKEVGSIIIM Odontella APLLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWRERFLYCLEGINRASAATGEVKGSYLNITAATMEEVYKRADYAKQIGSVIVI Guillardia RPLLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWKERFLFGIEGVNRAAAAAGEVKGHYFNVTAGTMEDMYERAEFCKEIGSVICM Porphyra RPFLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWRERFLYSMEGVNKASAAAGEIKGHYLNVTAATMEDMYERAEFSKVVGSIICM Arabidopsi HDLTGGFTANTSLSHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGDRESTLGFVDLLRDDYVEKDRSRGIFFTQD Nicotiana HDLTGGFTANTSLAHYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDFVEQDRSRGIYFTQD Oryza HDLTGGFTANTSLAHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREMTLGFVDLLRDDFIEKDRARGIFFTQD Pinus HDLTGGFTANTSLAHYCRDNGLLLHIHRAMHAVIDRQRNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGERDVTLGFVDLLRDDFIEKDRSRGIYFTQD Marchantia HDLTGGFTANTSLAFYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHAGTVVGKLEGDRQVTLGFVDLLRDDYIEKDRSRGIYFTQD Nephroselm HDLTGGFTANTSLAYYCRDNGLLLHIHRAMHAVIDRQRNHGIHFRVLAKALRLSGGDHLHSGTVVGKLEGEREVTLGFVDLMRDAYVEKDRSRGIYFTQD Chlorella HDLTGGFTANTSLSHYCRDNGLLLHIHRAMHAVIDRQRNHGITFRVLAKALRLSGGDHLHSGTVVGKLEGEREVTLGFVDLMRDDYIEKDRSRGIYFTQD Chlamydomo HDLTGGFTANTSLAIYCRDNGLLLHIHRAMHAVIDRQRNHGIHFRVLAKALRMSGGDHLHSGTVVGKLEGEREVTLGFVDLMRDDYVEKDRSRGIYFTQD Mesostigma HDLTGGFTANTSLAAYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRLSGGDHLHSGTVVGKLEGEREVTLGFVDLMRDDYIEKDRSRGVYFTQD Cyanophora HDITAGFTSNTTLARWCRDNGPLLHIHRAMHAVIDRQKNHGIHFRVLAKTLRMSGGDHLHSGTVVGKLEGDRAGTLGFVDLMRDDHIEQDRSRGIFFTQD Cyanidium IDLVIGYTAIQSMAIWARENNMILHLHRAGNSTYARQKNHGINFRVICKWMRMAGVDHIHAGTVVGKLEGDPIIVKGFYNTLLLPKLDVNLPQGLFFEMD Odontella IDLVMGYTAIQSAAIWARDNDMLLHLHRAGNSTYARQKNHGINFRVICKWMRMSGVDHIHAGTVVGKLEGDPLMIKGFYDVLRLTTLDVNLPYGIFFDMS Guillardia IDLVIGYTAIQSMAIWARKNSMILHLHRAGNSTYSRQKTHGMNFRVICKWMRMAGVDHIHAGTVVGKLEGDPLMVKGFYNTLLETQTDVNLVQGLFFAQD Porphyra IDLVIGYTAIQSMAIWARKNDMILHLHRAGNSTYSRQKNHGMNFRVICKWMRMAGVDHIHAGTVVGKLEGDPLMIKGFYNTLLAGETEINLPQGLFFAQN Arabidopsi WVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLEGNEIIRSPLAAACEVWKEITFNFPTIDMT Nicotiana WVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVALEACVKARNEGRDLEGNEIIRSPLAAACEVWKEIVFNFAAVDMT Oryza WVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAAANRVALEACVQARNEGRDLEGNEIIRSPLAAACEIWKAIKFEFEPVDMT Pinus WVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLEGNEVIRSPLAAACEIWKEIKFEFDVIDMT Marchantia WVSLPGVFPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVSLEACVQARNEGRDLEGNEIIRSPLSAACEIWKEIKFEFDIIDMT Nephroselm WASLPGVMPVASGGIHVWHMPALVEIFGDDACLQFGGGTLGHPWGNAPGAAANRVALEACTQARNEGRDLEGGDVIRSPLAAACEVWKEIKFEFDTVDMT Chlorella WVSLPGTMPVASGGIHVWHMPALVEIFGDDACLQFGGGTLGHPWGNAPGAAANRVALEACTQARNEGRDLEGGDVIRSPLAAACEVWKEIKFEFETIDMT Chlamydomo WCSMPGVMPVASGGIHVWHMPALVEIFGDDACLQFGGGTLGHPWGNAPGAAANRVALEACTQARNEGRDLEGGDVIRSPLAAACEVWKEIKFEFDTIDMT Mesostigma WCSMGGVMPVASGGIHVWHMPALTEIFGDDSCLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLEGNDVIRSPLAAACEVWKEIKFEFETIDMT Cyanophora WASMPGVMPVASGGIHIWHMPALVDIFGDDSCLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRNLEGNEIIRSPLAAACEVWKEIKFEFETIDMG Cyanidium WASLRKTVPVASGGIHAGQMHLLLKYLGDDVVLQFGGGTLGHPDGIQAGATANRVALEAIVLARNEGRDYEGPQILKGPLQTSLDLWKDISFNFTSTDMT Odontella WASLRKCMPVASGGIHCGQMHQLIHYLGDDVVLQFGGGTIGHPDGIQAGATANRVALEAMVLARNEGADYVGPQILRGPLQTALDLWKDISFNYTSTDMT Guillardia WAALNKCMPVASGGIHCGQMHQLINYLGDDVVLQFGGGTIGHPDGIQAGATANRVALECMVVARNEGRDYEGPQILRGPLQTALDLWKDITFNYASTDMT Porphyra WASLRKVVPVASGGIHAGQMHQLLDYLGDDVVLQFGGGTIGHPDGIQAGATANRVALESMVMARNEGRDFEGPQILRGPLQTALDLWKDISFNYTSTDMT Arabidopsi GRIPLWVIGTVAGILVIGLIGIFFYGMTQSNPNEQSVELNRTSLYWGLLLIFVLAVLFSNYFFNYPIFTVRWLAVHGLAVPTVSFLGSISAMQFIQRMGS Nicotiana GRIPLWIIGTVAGILVIGLIGIFFYGTTQSNPNEQNVELNRTSLYWGLLLIFVLAVLFSNYFFNYPIFTVRWLAVHGLAVPTVFFLGSISAMQFIQRMGS Oryza GRIPLWLIGTVTGIAVIGLIGVFFYGMTQSNPNEQNVELNRTSLYWGLLLIFVLAVLFSNYFFNYPIFTVRWLAVHGLAVPTVFFLGSISAMQFIQRMGS Pinus GRIPLWLIGTVTGIIVIGLLGVFFYGMTRPNPNDQNVELNRTSLYWGLLLIFVLAVPFSNYFFNYPIFTVRWLAVHGLAIPTVFFLGSISAMQFIQRMGN Marchantia GRVPLWLIGTVAGILVIGLVGIFFYGMTQPNPNKQSVELNRTSLYWGLLLIFVLAVLFSNYFFNYPIFTVRWLAVHGLAVPTVFFLGAISAMQFIQRMGN Nephroselm GRVPLWFVGMIVGLAALGLLGIFFYGMTKPNPNKQTVELNRTSLYWGLLLIFVLAILFSSYIFNYPIFTVRWLAVHALAVPTVFFLGSISAMQFIQRMGS Chlorella GRIPLWLVGTVAGTAALTLVAVFFYGMAKPNPNKQSVELNRTSLYWGLLLIFVLAVLFSSYIFNYPIFTVRWLAVHALAVPTVFFLGAITAMQFIQRMGA Chlamydomo GRIPLWLVGTEEGTLAIGAISCFFYGMARPNPNKQVVELNRTSLYWGLLLIFVLAVLFSSYIFNYPIFTVRWLAIHGIAVPTIFFLGAITAMQFIQRMGK Mesostigma GRIPLWLVGTVVGLLAIGLLALFFYGMTEPNPNKQEVELNRTSLYWGLLLIFVLAILFSSYIFNYPIFTVRWLSVHALAVPTVFFLGAISAMQFIQRMGS Cyanophora GRIPLWLVATVAGLAAIGVLGIFFYGMVSQNPNRQKVELNRTSLFWGLLLIFVLAILFSSYIFNYPIFTVRWLAIHAIGIPAVFFIGSITAMQFIQRMGT Cyanidium GRIPLWLVVTFGGIVVLTVLGIFIYGMSGINPNKQPVELNRTSLFWGLLLIFVLAVLFSSYFFNYPIFTFRWLAIHGLAIPTVFFFGAITAMQFIQRMGS Odontella GRIPLWLVGLVGGLAVITMLSLFLYGMTGPNPNKQAVELNRTSLYWGLLLIFVLAVLFSSYFFNYPIFTFRWLAIHGLAIPTVFFLGGITAMQFIQRMGS Guillardia GRIPLWIIATFGGIAALTVVGLFIYGMSGPNPNKQPVELNRTSLFWGLLLIFILAVLFSSYFFNYPIFTFRWLAIHGLAVPTVFFLGAITSMQFIQRMGS Porphyra GRIPLWLVATVGGMAAITVLGIFIYGMSGPNPNKEPVDLNRTSLFWGLLLIFVLAVLFSSYFFNYPIFTFRWLAIHGLAIPTVFFLGAITSMQFIQRMGS Arabidopsi TGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLITGRFDPLEMGLPWYRVHTVVLNDPGRLLAVHIMHTALV Nicotiana TGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLITGRFDPLEMGLPWYRVHTVVLNDPGRLLSVHIMHTALV Oryza TGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLITDRFDSLEMGLPWYRVHTVVLNDPGRLLSVHIMHTALV Pinus TGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQEVPLVTGRFDPLEMGLPWYRVHTVVLNDPGRLISVHIMHTALV Marchantia TGERPFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTENRQEVPLITGRFNSLEMGLPWYRVHTVVLNDPGRLIAVHLMHTALV Nephroselm TGERPFSDILTSIRYWVIHSITIPSLFVAGWLFVSTGLAYDVFGSPRPNEYFTEERQTTPLITDRFNALQMGLPWYRVHTVVLNDPGRLIAVHLMHTALV Chlorella TGERPFSDILTSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTEDRQETPLITDRFNALEMGLPWYRVHTVVLNDPGRLIAVHLMHTSLV Chlamydomo PVERPFSDILTSIRYWVIHSITVPALFIAGWLFVSTGLAYDVFGTPRPNEYFTEDRQEAPLITDRFNALEMGLPWYRVHTVVINDPGRLISVHLMHTALV Mesostigma TEERPFSDIITSIRYWVIHSITIPSLFVSGWLFVSTGLAYDVFGTPRPNEYFTEDRQDIPLITDRFNALEMGLPWYRVHTVVLNDPGRLISVHIMHTGLV Cyanophora TGERPFSDIVTSIRYWVIHTVTIPSLFVAGWLFVSTGLAYDVFGTPRPDEYFTEERQEVPIINQRFSTN*MGLPWYRVHTVVLNDPGRLIAVHLMHTALV Cyanidium TGERPFSDIITSVRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGTPRPNEYFSENRQQVPLINDRFNAREMALPWYRVHTVVLNDPGRLISVHLMHTALV Odontella TGERPFSDIITSVRYWIIHSITIPSLFVSGWLFVSTGLAYDVFGTPRPNEYFTQDRQQIPLVNDRFSAKQMALPWYRVHTVVLNDPGRLIAVHLMHTALV Guillardia TGERPFSDIITSIRYWIIHSITIPALFVAGWLFVSTGLAYDIFGTPRPNEYFTQERQQVPLVNDRFSAKQMGLPWYRVHTVVLNDPGRLIAVHLMHTALV Porphyra TGERPFSDIITSVRYWVIHSITIPALFVAGWLFVSTGLAYDVFGTPRPNEYFTQDRQQVPLVNDRFNAKQMGLPWYRVHTVVLNDPGRLIAVHLMHTALV Arabidopsi AGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDLEIFCDERTGK Nicotiana AGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDLEIFCDERTGK Oryza SGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWSISGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDLEIFCDERTGK Pinus AGWAGSMTLYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGIKDSWSGWNITGETVINPGIWSYEGVAVAHIVFSGLCFLAAIWHWVYWDLDIFCDERTGK Marchantia SGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITKSWGGWSITGETVTNAGIWSYEGVAAVHIVLSGLLFLAAIWHWVYWDLELFRDERTGK Nephroselm SGWAGSMALYEISVFDPSDPVLNPMWRQGMFVIPFMTRLGVTKSWGGWSITGESVSNPGIWSYEGVATAHILLSGALFMAAIWHWVFWDLELFRDPRTGE Chlorella SGWAGSMAFYELAVFDPSDPVLNPMWRQGMFVLPFMTRLGITQSWGGWTISGETAANPGVWSYEGVAAAHIVLSGLLFAASIWHWVYWDLELFRDPRTSN Chlamydomo SGWAGSMALFEISVFDPSDPVLNPMWRQGMFVLPFMTRLGITQSWGGWTISGETATNPGIWSYEGVAAAHIILSGALFLASVWHWTYWDLELFRDPRTGK Mesostigma SGWAGSMAFYELAVFDPSDPVLNPMWRQGMFVLPFMTRLGISKSWGGWDINGDSITDPGLWSYEGVAATHIILAGLMFLASMWHWVYWDLELFRDPRTGK Cyanophora AGWAGSMALYEIAVFDPSDPVLNPMWRQGMFVLPFMVRLGITNSWGGWTINGENVTDPGFWSFEGVAAAHIGLSGLLFLAAIWHWVYWDLELFRDPRTGE Cyanidium SGWAGSMALYELAVFDPSDPVLNPMWRQGMFVMPFMARLGVTDSWGGWSITGESVSNPGLWSFEGVALTHIVLSGLLFLASIWHWVYWDLDLFRDPRTLE Odontella AGWAGSMALYELAVFDPSDPVLNPMWRQGMFVMPFMTRLGITDSWGGWSITGESVSNPGIWSFEGVALSHIILSGMCFLAAIWHWVYWDLELFRDPRTGE Guillardia AGWAGSMALYELAVFDPSDPVLNPMWRQGMYVMPFMARIGVTDSWGGWSITGESVSNPGFWSFEGVALAHIGLSGLLFLAAVWHWVYWDLELFRDPRTGN Porphyra AGWAGSMALYELAVFDPSDPVLNPMWRQGMFVMPFMARLGVTDSWGGWSITGESVSNPGLWSLEGVALTHIVLSGMLFLAAIWHWVYWDLELFRDPRTGE Arabidopsi PSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQPVNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLR Nicotiana PSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQPVNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLR Oryza PSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQAVNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLR Pinus RCLDLPKVFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKIQPVDPAWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVRPPQRLYVGLR Marchantia PSLDLPKIFGIHLFLSGVLCFAFGAFHVTGLFGPGIWISDPYGLTGKVQPVAPAWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKGLR Nephroselm PALDLPKIFGIHLFLSGLLCFGFGAFHVTGLYGPGIWVSDPYGITGSVQPVEPAWGPEGFDPFNPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKALR Chlorella PALDLPKIFGIHLFLSGVLCFGFGAFHVTGIFGPGIWVSDPYGITGTVQAVAPSWDATGFDPYNPGGISAHHIAAGILGVLAGLFHLCVRPPQRLYNGLR Chlamydomo TALDLPKIFGIHLFLSGLLCFGFGAFHVTGVFGPGIWVSDPYGLTGSVQPVAPSWGADGFDPYNPGGIASHHIAAGILGVLAGLFHLCVRPSIRLYFGLS Mesostigma PALDLPKIFGIHLFLSGLLCFGFGAFHVTGLFGPGIWVSDPYGITGRVQPIEPSWGADGFDPFNPGGIASHHIAAGILGILAGLFHLSVRPSFRLYKALR Cyanophora PALDLPKMFGIHLFLSGLLCFGFGAFHLTGLFGPGMWVSDAYSITGRVQPVAPAWGPEGFNPFNPGGVVSHHIAAGIVGILAGLFHLSVRPPQRLYKALR Cyanidium PALDLPKVFGIHLVLSSLLCFGFGAFHVTGLFGPGIWISDAYGLTGRIQSVAPAWGPEGFNPFNPGGIASHHIAAGTVGILAGVFHLNVRPPQRLYRALR Odontella PALDLPKIFGIHLFLSGLLCFGFGAFHVTGLFGPGIWVSDAYGVTGKVQPVAPAWGADGFNPFNPGGIAAHHIAAGIFGIFAGIFHLTVRPPQRLYRALR Guillardia PALDLPKIFGIHLVLAGLLCFGFGAFHVTGAWGPGIWVSDAYGITGKVQPVAPTWGPEGFNPFNPSGVASHHIAAGILGFIAGIFHIAVRPPQRLYRALR Porphyra PALDLPKIFGIHLLLSSLLCFGFGAFHVTGLFGPGMWVSDGYGVTGKVLPVAPAWGPEGFNPFNPGGVASHHIAAGTVGILAGVFHLTVRPPQRLYRALR Arabidopsi MGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSEAWAKIPEKLAFYDYIGNNPAKGGLFRAGSM Nicotiana MGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSEAWSKIPEKLAFYDYIGNNPAKGGLFRAGSM Oryza MGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSDGLAENLSLSEAWSKIPEKLAFYDYIGNNPAKGGLFRAGSM Pinus MGNIETVLSSSIAAVFFAAFIVAGTMWYGSATTPVELFGPTRYQWDQGYFQQEIDRRVRAGLAENLSLSEAWSKIPEKLAFYDYIGNNPAKGGLFRAGAM Marchantia MGNVETVLSSSIAAVFFAAFVVAGTMWYGSAATPIELFGPTRYQWDQGFFQQEIDRRIRSSKAENLSLSEAWSKIPEKLAFYDYIGNNPAKGGLFRAGAM Nephroselm MGNVETVLSSSIAAVFWAAFVVSGTMWYGSAATPIELFGPTRYQWDQGFFQQEIEKRVQGSLASGASLSDAWAKIPEKLSFYDYIGNNPAKGGLFRAGAM Chlorella MGNIETVLSSSIAAVFWAAFVVSGTMWYGSAATPIELFGPTRYQWDLGFFQQEIERRVQTNLSEGKSASQAWAEIPEKLAFYDYIGNNPAKGGLFRAGAM Chlamydomo MGSIETVLSSSIAAVFWAAFVVAGTMWYGSAATPIELFGPTRYQWDQGFFQQEIQKRVQASLAEGASLSDAWSRIPEKLAFYDYIGNNPAKGGLFRTGAM Mesostigma MGNVETVLSSSIAAVFWAAFVVSGTMWYGSAATPIELFGPTRYQWDLGYFNKEINKRVQASIASGSTASEAWSRIPEKLAFYDYIGNNPAKGGLFRAGAM Cyanophora MGNIETVLSSSISAVFFAAFIVAGTMWYGSAATPVELFGPTRYQWDQEYFHQEMERRVQKDVAAGASLSEAWNRIPAKLAFYDYIGNNPAKGGLFRAGPM Cyanidium MGNIETVLSSSIAAVFFASFVVSGTMWYGAASTPIELFGPTRYQWDSGYFQQEIEKRVEESLSNGLSLPEAWSNIPDKLAFYDYIGNNPAKGGLFRAGPM Odontella MGNIETVLSSSIAAVFFAAFVTSGTMWYGAAATPIELFGPTRYQWDSGYFQQEIERQVETSVSEGLSESQAWSRIPDKLAFYDYIGNNPAKGGLFRAGPM Guillardia MGNIETVLSSSIAAVFFAAFITTGTMWYGSATTPIELFGPTRYQWDSGYFQQEIERRVENSLNEGLSLSEAWSRIPDKLAFYDYVGNNPAKGGLFRAGPM Porphyra MGNIETVLSSSISAVFFSAFITCGTMWYGSATTPIELFGPTRYQWDSGYFQQEIEKRVENAIADGAAPSEAWSRIPDKLAFYDYIGNNPAKGGLFRAGPM Arabidopsi DNGDGIAVGWLGHPVFRNKEGRELFVRRMPTFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKYARRAQLGEIF Nicotiana DNGDGIAVGWLGHPIFRDKEGRELFVRRMPTFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKYARRAQLGEIF Oryza DNGDGIAVGWLGHPIFRDKEGRELFVRRMPTFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKYARRSQLGEIF Pinus DNGDGIAVGWLGHPIFKDKEGNELFVRRMPTFFETFPVVLVDKEGIVKADVPFRRAESKYSVEQVGVTVEFYGGGLDRVSFGDPAIVKKYARRAQLGEIF Marchantia DNGDGIAVGWLGHAVFKDKEGNELFVRRMPTFFETFPVVLVDEQGIVRADVPFRRAESKYSVEQVGVTVEFYGGELDGVSFSDPATVKKYARRAQLGEIF Nephroselm NSGDGIAAGWLGHPVFTDKAGNELFVRRMPTFFETFPVLLVDKDGVVRADVPFRRAESKYSIEQVGVSVTFYGGELDGVTFNDPSTVKKYARRAQLGSVF Chlorella NSGDGIAVGWLGHAVFKEKQGNELFVRRMPTFFETFPVVLVDKDGVVRADVPFRRSESKYSIEQVGVSVTFYGGELDGVTFNDPATVKKYARRAQLGEIF Chlamydomo NSGDGIAVGWLGHASFKDQEGRELFVRRMPTFFETFPVLLLDKDGIVRADVPFRKAESKYSIEQVGVSVTFYGGELDGLTFTDPATVKKYARKAQLGEIF Mesostigma NNGDGIAAGWLGHAVFKDKEGRELFVRRMPTFFETFPVVLLDKDGIVRADIPFRRAESKYSIEQVGVSVAFYGGELDGVTFKDPTTVKKYARRAQLGEIF Cyanophora NKGDGIAESWLGHATFKDKEGRELTVRRMPTFFETFPVVLIDKDGVLRADIPFRRAESKYSIEQMGVTVSFYGGKLDGQTFTDAPTVKKYARKAQLGEAF Cyanidium NKGDGIAEAWLGHPVFQDKEGHELIVRRMPAFFENFPIILVDKDGIIRADIPFRRAESKYSIEQVGVTCSFYGGKLNNQSFKDASTVKKYARKAQFGEVF Odontella NKGDGIAEAWLGHPIFRDKDGRELTVRRMPAFFETFPVILVDKDGIIRADIPFRRAESKYSIEQVGVTVDFYGGKLNGQTFKDAPTVKKFARKAQLGEVF Guillardia NKGDGIAEAWLGHPVFQDKEGRELTVRRMPAFFETFPVILVDKDGIIRADIPFRRAESKYSVEQVGVTVSFYGGKLNGQTYTDAPTVKKYARKAQLGEVL Porphyra NKGDGVAEAWLGHPVFQDKEGRELSVRRMPAFFETFPVILVDKDGIIRADIPFRRAESKYSIEQVGVTASFYGGKLNGQVFNDAPSVKKYARKAQLGEVF Arabidopsi ELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFAGIDPDLDAQVEFGAFQKLGDPTTKRQAMSKVYDWFEERLEIQAIADDITS Nicotiana ELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFAGIDPDLDAQVEFGAFQKLGDPTTKRQAMNKVYDWFEERLEIQAIADDITS Oryza ELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFADVFAGIDPDLDAQVEFGAIQKRGDPTTGRQPMNKVYDWFEERLEIQAIADDITS Pinus ELDRATLKSDGVFRSSPRGWFTFGHATFALLFFSGHIWHGARTLFRDVFAGIDSDLDDRIEFGAFQKLGDPTTKRQVMNKVYDRFEERLEIQAIADDITS Marchantia EFDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFAGIDPDLDAQVEFGAFQKLGDPTTKRQVMNKVYDWFEERLEIQAIADDITS Nephroselm EFDRATLQSDGVFRSSPRGWFTFGHLWFALLFFFGHIWHGARTIFRDVFGGIDPDLDDQVEFGAFQKLGDVTTRRQAMSKIYDWFEERLEIQAIADDITS Chlorella EFDRATLQSDGVFRASPRGWFTFAHLCFALLFFFGHIWHGARTIFRDVFAGIDADLDEQVEFGAFLKLGDTSTRRQSMGKVYDWFEERLEIQSIADDISS Chlamydomo EFDRSTLQSDGVFRSSPRGWFTFGHVCFALLFFFGHIWHGARTIFRDVFAGIDDDINDQVEFGKYKKLGDTSSLREAMSKVYDWFEERLEIQAIADDITS Mesostigma EFDRARLKSDGVFRSSPRGWFTFGHLCFALLFFFGHIWHGARTIFRDVFAGIDPDLDEQVEFGAFQKLGDASTRKQAMSKVYDWFNDRLEIQGIADDITS Cyanophora EFDRETLKSDGVFRSSARGWFTFGHASFALIFFFGHLWHGGRTLFRDVFAGIGEEVTEQVEFGAFQKVGDKTTRKQEMSKVYDWFQERLEIQAIADDITS Cyanidium EFDRTILDSDGVFRSSPRGWFTFGHANFALLFFFGHLWHGSRTLFRDVFAGIGAEVTEQVEFGVFQKVGDKTTKKQGMSKFYDWFQERLEIQLIADDISA Odontella EFDRTSLESDGVFRSSPRGWYTFGHANFALLFFFGHLWHGGRTIFRDVFTGIGAEVTEQVEFGAFQKLGDKSTKKQGMGKVYDWFEERLEIQAIADDISS Guillardia EFDRTTLESDGVFRSSPRGWYTFGHANFALLFFLGHLWHGSRTLFRDVFSGIGAEVTEQVEFGAFQKLGDRSTKKQGMGKVYDWFEERLEIQAIADDITS Porphyra EFDRTTLESDGVFRSSPRGWFTFGHANFALIFFFGHLWHGSRTIFRDVFAGIGAEVTEQVEFGAFQKLGDRSSKKQGMSKIYDWFEERLEIQAIADDISS Arabidopsi KYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVV Nicotiana KYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVV Oryza KYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVV Pinus KYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTVTEAFASVQYLMTEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVI Marchantia KYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTVTEAFSSVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHIFRVYLTGGFKKPRELTWVTGVI Nephroselm KYVPPHVNIFYCFGGITLTCFLIQVATGFAMTFYYRPTVTEAFASVEYIMTNVNFGWLIRSIHRWSASMMVMMLILHVFRVYLTGGFKKPRELTWVTGVI Chlorella KYVPPHVNIFYCIGGITFTCFLVQVATGFAMTFYYRPTVAEAFASVQYIMTEVNFGWLIRSIHRWSASMMVLMMILHVCRVYLTGGFKKPRELTWVTGVI Chlamydomo KYVPPHVNIFYCIGGITFTCFLVQVATGFAMTFYYRPTVAEAFASVQYIMTDVNFGWLIRSIHRWSASMMVLMMVLHVFRVYLTGGFKRPRELTWVTGVI Mesostigma KYVPPHVNIFYCIGGITFTCFIMQVASGFAMTFYYRPTVTEAFASVQYIMTDVNFGWLIRSIHKWSASMMVLTMILHVFRVYLTGGFKKPRELTWVTGVI Cyanophora KYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTVTEAFASVQYIMTDVNFGWLIRSTHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVVGVI Cyanidium KYVPPHVNVFYCFGGMTLTCFLVQLATGFAMTFYYKPTTIEAFSSIQHIMTQVSFGWLIRSLHRWSASMMVLMMILHIFRVYLTGGFKKPRELTWITGVI Odontella KYVPPHVNIFYCFGGIVFTCFLVQVATGFAMTFYYRPSVVDAFASVEYIMTSVNFGWLIRSIHRWSASMMVMMMVLHVFRVYLTGGFKKPRELTWVTGVI Guillardia KYVPPHVNIFYCIGGITFTCFIIQVATGFAMTFYYRPTVAEAFASVEYIMTEVNYGWLFRSMHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVT Porphyra KYVPPHVNIFYCLGGIVFVSFLIQVATGFAMTFYYRPTVAEAFTSVEYIMTDVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVI Arabidopsi LGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPLMGVTKKPD Nicotiana LAVLTASFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPLMGVTKKPD Oryza LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPLMGVTKKPD Pinus LAVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSVSVGQSTLTRFYSLHTFILPLLTAVFMPMHFLMIRKQGIPGPLMGVTKKPD Marchantia LAVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPIIGSPLVELLRGSVSVGQSTLTRFYSLHTFVLPLLTAIFMLMHFLMIRKQGISGPLMGVTKKPD Nephroselm LAVITVSFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGAPLVELLRGSVSVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPLMSVTKKPD Chlorella MAVCTVSFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVVGPALVELLRGGVGVGQSTLTRFYSLHTFVLPLATAVFMLMHFLMIRKQGISGPLMAVTKKPD Chlamydomo MAVCTVSFGVTGYSLPWDQVGYWAVKIVTGVPDAIPGVGGFIVELLRGGVGVGQATLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPLMSVTKKPD Mesostigma LAVCTVSFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGAPLVELLRGGVGVGQSTLTRFYSLHTFVLPLLTAVFMLAHFLMIRKQGISGPLMSLQKKPD Cyanophora LAVITVSFGVTGYSLPWDQVGYWAVKIVTGVPEAIPVIGSNVVELLRGSVSVGQSTLTRFYSLHTFVLPLLSAVFMLVHFLLIRKQGISGPLMSILKKPD Cyanidium LAVLTVSFGVTGYSLPWDQVGYWACKIVTGVPEAIPVVGDNVVEILRGGTGVGQATLTRFYSLHTLFLPALSVIFLLAHFLMIRKQGISGPLMTIIKKPD Odontella LAVVTVSFGVTGYSLPWDQVGFWACKIVTGVPAAVPVVGPPLVLVLRGGESVGQSTLTRFYSAHTFVLPLAAAVLMLTHFLMIRKQGISGPLMSVIKKPD Guillardia LAVVTVSFGVTGYSLPWDQVGYWACKIVTGVPEAIPVVGSLLVELLRGSVSVGQATLTRFYSAHTFVLPVAAAVLMLTHFLMIRKQGISGPLMSVLKKPD Porphyra LGVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPDAVPVVGESIVELLRGGVSVGQGTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPLMSILKKPD Arabidopsi LNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGL Nicotiana LNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGL Oryza LNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPTGL Pinus LNDPVLRAKLAKGMGHNYYGEPAWPNDLSYIFPVVILGTIACTIGLAVLEPSMIGEPANPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMGSVPAGS Marchantia LSDPILRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACTVGLAVLEPSMIGEPANPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMAAVPAGL Nephroselm LTDPVLRAKLAKGMGHNYYGEPAWPNDLLYMFPVVILGTLSCITGLAVLDPAAIGEPANPFATPLEILPEWYFFPVFQLLRTVPNKLLGVLLMAAVPAGL Chlorella LSDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIFGTFACVIGLSVLDPAAIGEPANPFATPLEILPEWYFYPVFQILRVVPNKLLGVLLMAAVPAGL Chlamydomo LSDPVLKAKLAKGMGHNTYGEPAWPNDLLYMFPVVILGTFACVIGLSVLDPAAMGEPANPFATPLEILPEWYFYPVFQILRVVPNKLLGVLLMAAVPAGL Mesostigma LKDPVLRAKLAKGMGHNYYGEPAWPNDLLYTFPVCILGTIGCLVGLAVLEPTMFGEPANPFATPLEILPEWYFFPVFQILRVIPNKLLGVVLMAGVPAGL Cyanophora LNDPELRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGSIACCGGLAVLDPALIGEPADPFSTPLEILPEWYFFPVFQILRVIPNKLLGVVLMAAVPAGL Cyanidium LNNALLRAKLAKGMGHSYYGEPAWPNDLLYTFPIVILGTITCCVGLAVLEPSSLGEPANPFATPLEILPEWYLYPTFNMLRIIPNKLFGVISISLVPVGL Odontella LTDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVCILGTFACCIGLAVMAPTQMGEPADPFNTPLEILPEWYFFPTFNLLRVLPNKLLGVLAMARVPAGL Guillardia LTDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTLACVIGLSVLAPSPIGEKADPFATPLEILPEWYFFPTFNLLRVIPNKLLGVLSMAAVPVGL Porphyra LTDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVILGTIACSIGLAILEPSSLGEKSNPFATPLEILPEWYFFPTFNLLRVIPNKLLGVLSMAAVPAGL Arabidopsi LTVPFLENVNKFQNPFRRPVATTVFLIGTAAALWLGIGATLPIDKSLTLGLFMGKDTIADIITSIRNADMNRKGTVRIGSTNITESIVKILLREGFIENV Nicotiana LTVPFLENVNKFQNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLFMGRDTIAEIITSIRNADMDRKRVVRIASTNITENIVQILLREGFIENV Oryza LTVPFLENVNKFQNPFRRPVATTVFLIGTAVALWLGIGATLPIEKSLTLGLFMGKDTIADLLTSIRNADMNKKGTVRVVSTNITENIVKILLREGFIESV Pinus LTVPFLENVNQFQNPFRRPVATTVSLIGTAVALWLGIGAALPIDESLTLGLFMGNDTITNLITSIRNADMVEKGTVRVTATNITKNIGRILLREGFIEDV Marchantia LTVPFLENVNKFQNPFRRPVATTVFLIGTVVALWLGIGAALPIDKSLTLGLFMGNDTIANMITSIRNANLGKIKTVQVPATNITRNIAKILFQEGFIDNF Nephroselm LTVPFIESINKFQNPFRRPVATTVFLIGTVVAIWLGIGATLPIDISLTLGLFMIQDTIADMLTRIRNANAMRIYTVCMPMTSVAREIAVILETEGWIDSW Chlorella LTVPFIENINKFQNPFRRPVATTVFLIGTVAAIWLGIGAALPIDISLTLGLFMVNDTISDMLTRIRNANLAKKTSVSLPKTKVHEKMCQILEQEGFIKTF Chlamydomo ITVPFIESINKFQNPYRRPIATILFLLGTLVAVWLGIGSTFPIDISLTLGLFLINDSIGDMLTRIRNACLAKKSSVSIPFTRLNQNIAQILEQEGFIQTY Mesostigma LTVPFIESINKFQNPFRRPVAMTVFLIGTVVAVWLGIGATLPIDTSLTLGFFMVNDTIADMITRIRNANLITQKQVAVIASNTNKGIAQCLLKEGFIESI Cyanophora IAVPFIENVNKFQNPFRRPVASAVFLFGTFVAIWLGIGATFPIDKSLTLGLFMVNDTIADMLTGIRNANLAKHKVARVKATKITRCLANVLKEEGLIQNF Cyanidium GIVPFVENINKFQNPFRRPIATSVFIFGTVTTVWLGIGATMSIDKALTLGIFMVNDSISDMLTRLRNAICAQHKVVQVPLTNINKNILKVLQKEGYIKNF Odontella ITVPFIENVNKFQNPFRRPIASLVFILGFFTAVWLGIGACLPIDKAVSLGFWMVTDTISDMLTRIRNANMIKHQIVQIPATKMSKAITNILKEEGFIEDY Guillardia ITVPFIESVNKFQNPFRRPVAMTVFVFSVVFAIWLGIGATMPINKALTLGLFMTNDTVSDMLTRVRNANLAKHQVVQVPATKMTKSIAHVLLEEGFIESI Porphyra LTVPFIENVNKFQNPFRRPIATTIFLISTVITIWLGIGATMPINNAITLGLFMVNDTVADMLTRIRNANLARHQIVQVPATKVTRNMALVLKEEGFVHNF Arabidopsi LKRISRPGLRIYSNSQRIPRILGGIGIVILSTSQGIMTDARIGGEILCYIWMLSPKRTRFRKQHRGRLKGISSRGNRICFGRYALQTLEPAWITSRQIEA Nicotiana LKRISRPGLRIYSNYQRIPRILGGMGIVILSTSRGIMTDARIGGEILCYIWMLSPKRTRFRKQHRGRMKGISHRGNHISFGKYALQALEPAWITSRQIEA Oryza LKRISRPGLRIYANYQGIPKVLGGMGIAILSTSRGIMTDARIGGEVLCYIWMLSPKRTRFRKQHRGRMKGKSYRGNCICFGRYALQALEPTWITARQIEA Pinus SKRTSKPGLRIYSNYREIPKVLGGMGIVILSTSQGILTDARIGGEILCYVWMLSPKRTKFRKQHRGRMKGVSYRGNRICFGRFALQALEPAWITSGQIEA Marchantia LRRISKPGLRIYSNHKEIPKVLGGMGIVILSTSRGIMTDARIGGELLCYVWMLSPKRTKFRKQHCGNLKGISTRGNVICFGKFPLQALEPSWITSRQIEA Nephroselm LRRVSRSGCRVYVSAKEVPKVLGGMGTAIISTSKGIMTDARLGGEVICLIWMLSPKRTKFRRPHRGHRRGRALRGNTIAFGDFAIQALESSWVTSRQIEA Chlorella LKRISKPGLRIYTNSREIPKVLGGMGILILSTSKGLMTDARLGGEILCSVWMLSPKRTKYRKHHRGRMRGKASRGNTVVFGDYALQSLEASWITSRQIEA Chlamydomo LKRISKPGLRIYSNHKDILRILGGTGIVIVSTPEGLMTDARIGGELLCSVWMLSPKRTKFRKPHRGHLRGKATRGNKIVFGDFALQAQEPCWITSRQIEA Mesostigma LQRVSKSGLRVYTSYKDIPKVLGGIGIAILSTSQGILTDARIGGEILCYIWMLSPKRTKFRRHHRGKMRGVATRGNKVSFGDFGLKTLEPGWLTSRQIEA Cyanophora LKRISKPGLRGYANHKELPRVLGGLGIAILSTSSGIMTDARCGGEVLCYIWMLSPRRTKFRKQQRGRMKGISTRGNNLVFGDFGLQALEPAWITSRQIEA Cyanidium LKKISRPGLRMYVRTKKIPKVLGGTGIAIISTSKGVMTGARIGGEILCYIWMLSPKKTKYRKFHRGRLKGHATKGSALAFGRYGIQALTSSWITSRQIES Odontella MVRVSKPGLRVYSKSKKLPKVLDNLGIAIISTSKGVMTNAKIGGEVLCYIWMLSPKRTKYRKYHRGRMRGKATRGNEVTFGDYGLQALEPTWITSRQIEA Guillardia LKRISRPGLRVYANRKELPRVLGGLGIAVISTSKGVLTDARLGGEVLCYIWMLSPKRTKFRKPHRGRLRGIATRGNTLIFGDYGLQALEPIWLTSRQIEA Porphyra LKRISKPGLRVYANHKELPRVLGGLGIAIISTSQGVMTDARLGGEILCYIWMLSPKKTKFRKQHRGRMKGSASKGNTIAFGDYALQATEPVWLTSRQIEA Arabidopsi GRRAMTRNVRRGGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGKILYEMGGVPENIARKAISIAASKMPIMTRLKKNPFVAKHLLRKIEKLN Nicotiana GRRAMTRNARRGGKIWVRIFPDKPVTLRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARRAISLAASKMPIMTRLKKNPFVANHLLKKIDKLN Oryza GRRAMTRYARRGGKIWVRIFPDKPVTIRPTETRMGSGKGSPEYWVAVVKPGRILYEMGGVSETVARRAISIAASKMPIMTRKKTNPFVAHHLLAKIEKVN Pinus GRRTINRYARRGGKIWVRIFPDKPITMRPAETRMGSGKGSPEYWVSVIRPGRILYEMGGVSETVARAAARIAAYKMPIMARLKKNPFVANHSLRKIKNLN Marchantia GRRAITRYARRGGKLWIRIFPDKPITIRPAETRMGSGKGSPEYWVAVVKPGKILYEISGVSENIARAAMKIAAYKMPIMTRIKKGPFVADHLLKKIENLN Nephroselm ARRAMTRYARRGGKIWIRIFPDKAITMRPAETRMGSGKGSPEYWVAVVKAQKILFEMKGVPETIARASMRIACFKMPMMPRLKKGPFVANHLLRKIEKMN Chlorella ARRAMTRQVRRGGQIWIRLFPDKPVTMRPAETRMGSGKGAPEFWVAVVRPGKVLYELKGVPESVARVALRLAASKLPVMARLKKAPFVANHLLEKVERLN Chlamydomo GRRVLTRYVRRGGKLWIRIFPDKAVTMRPAGTRMGSGKGAPDYWVAVVHPGKILYEMQGVSETIARQAMRIAAYKMPVMSRLKKGPFVADHLLKKIEKLN Mesostigma GRRAMTRYTRRGGQLWIRVFPDKPVTIRPAETRMGSGKGSPEYWVAVVKPGTILYEMKGVTPEIARSAMRVAGFKMPVMARLKKGPFVADHLLKKIEFLN Cyanophora SRRAINRYVRRGGKIWIRIFPDKPVTMRPAETRMGSGKGAPEYWVAIVKPGRVIFEINGVSQEMAKAAFRIATFKLPIMARLKKGPFIAHHLLKKVELLN Cyanidium VRRVIVRHLKRGGKLWIRIFPDKAVTAKPLETRMGSGKGSPEHWIAVVKSGHILFEIDGVSLELAKEAVKLAIYKLPIMSRIKKGPYVHFKLLKNTNNLN Odontella ARRTITRYTKRGAALWIRIFPDKTVTARAAESRMGSGKGAVDYWVAVVKPGTILFEIASVPEEIAATALHLASYKLPIMPRLKKGPFVAYHLLKKIDKMN Guillardia TRRTITRQVKRVGRLWIRVFPDKSISAKPPETRMGAGKGAPEYWVAVIKPGHILFEINGVSQDLRYLAFKNASYKLPIMSRLSKGPYIAAHLLKKLNNVD Porphyra TRRTITRYVRRGGKLWIRVFPDKPVTARPAETRMGSGKGAPEYWVAVIKPGHILFEITGVPQKTAQQAMKLASYKLPIMSRIHKGPFIDVSLLTRIEALN Arabidopsi TKAEKEIIITWSRASTIIPTMIGHTIAIHNGREHLPVYIIDLMVGHKLGEFSPTINFRGHAKNDNRSRRMAIHLYKTSTPSTRNGVDSQVKSNPRNNLIC Nicotiana TKAEKEIIVTWSRASTIIPTMIGHTIAIHNGKEHLPIYITDSMVGHKLGEFAPTLNFRGHAKSDNRSRRMAIHLYKTSTPSTRNGVDSQVKSNPRNNLIY Oryza MKEEKETIVTWSRASSILPAMVGHTIAIHNGKEHIPIYITNPMVGRKLGEFVPTRHFYESARKDTKSRRTAKHLYKTPIPSTRKGIDRQVKSNPRNNLIH Pinus IKEEKKIIVTWSRASVIVPAMIGHTIAVHNGREHLPIYVTDRMVDHKLGEFAPTLLFQGHARNDKKSRRMAIRSYRILTPDTRNRVDGRVQLDPQKKLTS Marchantia LKKEKKIIITWSRASTIVPTMIGHTIAVHNGQEHLPIYITDRMVGHKLGEFAPTRTFRGHAKNDKKSRRMAIRLYRAYTPGTRNRVDEIVKCQPQKKLTY Nephroselm GKGEKHVITTWSRASTIIPIMIGHTIAIHNGKSHLPIFINDRMIGHKLGEFVLTRNYRGHGKTDKKARRMGIRFYRAHTPGTRNRVHEITTSTPTKSLTH Chlorella TQGDKKVIKTWSRSSTIVPLMIGHTIAVHNGREHIPVFITDQMVGHKLGEFAPTRTFRGHVKKDKKSKRMAIRFFKAATPGTRHGVSEITHKKPEKALTS Chlamydomo AKGKKVVIKTWSRSSMIVPPMIGHTIGVYNGREHIPVFVSDQMVGHRLGEFSPTRTYRGHAKKDKKAKRMGIRFLQAYTPGTRNRVSELTNSTPEKALTV Mesostigma VKKEKKVITTWSRGSTILPIMIGHTIAVHNGREHLPIFITDQMVGHKLGEFSPTRTFRGHTKSDKKSRRMGIRLYKAYTPGTRNRVNDITKTNPEKSLTY Cyanophora TSGKTEVIKTWSRASTILPMMVGHTIAVHNGRQHLPVFITDQMVGHKLGEFAPTRTFKGHTKSDKKARRMAIRSYKAYTPGTRNRISEITKSEPEKSLTF Cyanidium LSNSKRVIKTWSRSSVILPSMVGHTIAVHNGKIHVPIFISDQMVGHKLGEFAFTRSFRSHAKIDKKIRKMAIKKYKPYTPSMRGRVDFFDEKKAPKRLSF Odontella ASGKKDVITTWSRTSTILPTMVGHTIAVYNGRQHVPIFISDQLVGHKLGEFVSTRTFKSHIKTDKKTKRMSIRLYKSYTPGTRNRLTEITKTKPEKSLIQ Guillardia IQKPDVVIKTWSRSSTILPNMVGATIAVYNGKQHVPVYISDQMVGHKLGEFSPTRTFRSHIKSDKKAKRMGIRIYKSYTPGTRNRSVEITKSKPEKSLLR Porphyra TSGKKEVIKTWSRASTIIPDMIGHTIAVYNGKQHFPVFVSDQMVGHKLGEFVPTRTFRTHVKGDRKARRMAIRLYRAYTPGTRNRVSEITTDKPEKSLIN Arabidopsi QHGGRNARGIITARHRGGGHKRLYRKIDFRRAKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTIVSGTEVPIKMGNALPLTDMPLGT Nicotiana QHGGRNARGIITARHRGGGHKRLYRKIDFRREKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTIVSGTEVPIKMGNALPSTDMPLGT Oryza RHGGRNSRGIITARHRGGGHKRLYRKIDFRRQKDISGRIVTIEYDPNRNAYICLIHYGDGEKGYILHPRGAIIGDTIVSGTKVPISMGNALPSTDMPLGT Pinus QHGGRNGRGIITARHRGGGHKRLYRQIDFRRKEHISGEIVTIEYDPNRSAYICKVHYKNGDKMYILHPRGVMIGDTILSGPKAPISIGNALPSTNMPLGT Marchantia NKKGRNNRGIITSQHRGGGHKRLYRKIDFQRKKYITGKIKTIEYDPNRNTYICLINYEDGEKRYILYPRGIKLDDTIISSEEAPILIGNTLPLTNMPLGT Nephroselm ANAGRNHSGSITTRWRGGGHKRLYRQIDFRRKVGVLARVATVEYDPNRSARIALLHYQDGSKRYILHPQGLAIGAEVMSSPEAPISIGNALPLVNMPLGT Chlorella WWSGRNNRGIITSRHRGGGHKRLYREIDFARKVNVPAKVAYIEYDPNRNARIALVNYQDGEKKYILHPVGLQVGQTIIASPEASIAIGNCLPLVKIPLGT Chlamydomo SLAGRNNRGIITCRHRGGGHKRLYRQIDFRRKIGVTAKVVRIEYDPNRNARIALLRYEDGEKRYIIHPRGLNIGDIIQSDLNAPILIGNSLPLRNIPLGA Mesostigma HRSGRNNRGIITIRHRGGGHKRLCRLIDFTREKNIPATVASIEYDPNRNCRIALLYYKNGIKRYIIHPRGLSVGKEIVSSVEAPLSVGNSLPLNKIPLGT Cyanophora KHKGRNNRGIITTAHKGGGSKRLYRIIDFKRLKLVPAKVAAIEYDPNRNARIALLHYQNGEKGYILHARGLAVGNMVYSGPNAPIEVGNSLPLSEIPLAT Cyanidium IKSGRNNQGKITCRHKGGGHKRKYRLVDFKRKTGVLAKVSDIYYDPNRSAHIALLNYLDGEKSYIISPNLLKVGTYVVSGKEASPDIGNALPLNCVPLGF Odontella KNSGRNNRGVITIRHRGGGHKRRYRIIDFGRKHNVEGVVAAIEYDPNRNARIALLHYTDGEKRYILHPNNLNVGDRVVSGMEAELVIGNALPLEKIPLGA Guillardia KKCGRNNRGLITVRHKGGGHKQRYRLVDFKRKLDIPAIVASVEYDPNRNARIALLHYQDGEKRYILHPKKLAVGDKIYSGINVPIEIGNAMPLYNVPLGT Porphyra KHCGRNNRGVITCRHKGGGHKQRYRLIDFKRRHNIIAKVASIEYDPNRNARIALLHYLDGEKRYILHPRSLSVGAIVVSGPMAPIEVGNALPLSTIPLGT Arabidopsi AIHNIEITLGRGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRA Nicotiana AIHNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGVNQKSLGRAGSKRWLGKRPVVRGVVMNPVDHPHGGGEGRA Oryza AIHNIEITRGRGGQLARAAGAVAKLIAKEGKSATLRLPSGEVRLVSQNCLATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGKA Pinus AIHNIEITLGKGGQLARAAGAVAELIAKEDRSATLRLPSGEVRLISENCSATIGQVGNITANNRSFGKAGAKRWLGKRSEVRGVAMNPVDHPHGGGEGRT Marchantia AIHNIEITPGKGGQLVRAAGTVAKIIAKEGQLVTLRLPSGEIRLISQKCLATIGQIGNVDVNNLRIGKAGSKRWLGKRPKVRGVVMNPIDHPHGGGEGRA Nephroselm EVHNIELRPYNGGQLVRAAGAVAQLVAKEGGFGTLRMPSGEVRLVAKDCWATVGQVGHVESINLTLGKAGRSRWLDRRPRVRGSVMNACDHPHGGGEGRC Chlorella EVHNIELQPGSGGQLVRAAGTVAQIVAKEGTWASLRLPSGEVRLVSQNCWATIGRVGNIDAFNLTLGKAGRSRWLGRRPHVRGSAMNPVDHPHGGGEGRA Chlamydomo EVHNVEFQPGSGGQLARSAGAMVEILAKEGNFVTIRLPSKEIRLVSKNCWATVGQVGNIEAYNLTIGKAGRTRWLGKRPTVRGSVMNPVDHPHGGGEGRA Mesostigma GIHNIELSPGQGGQLARAAGAVAQLIAKEGKFVTVRLPSGEVRLILKECWATIGQVGNVDANNITIGKAGRTRWLGKRPVVRGVVMNPVDHPHGGGEGRS Cyanophora EIHNIELTPGKGGQLVRSAGSSAQLLAKEGNYVTLRLPSGEMRFVRKECYATIGQIGNAEISNISIGKAGRNRWLGIRPTVRGVVKNPVDHPHGGGEGRA Cyanidium EIHNIELIHGKGGQVARAAGTSAKLIAKSQDYVTIKLPSGEIRLFRGECYATIGKVGNIDHNNEKIGKAGRNRWLGIRPTVRGSAMNAVDHPHGGGEGRS Odontella SVHNIELIPNRGGQIVRAAGTSAKILAKEGDYVTLRLPSKEIRLIRKECFATIGEVSNNDAFLVQSGKAGRTRWLGKRPTVRGSVMNPCDHPHGGGEGRA Guillardia AVHNVELIPGRGGQIVRSAGTSAQVVAKDGQVVTIKMPSNEVRMIYKNCYATIGEVGNADIKNIRLGKAGRKRWLGIRPSVRGVVMNPCDHPHGGGEGRS Porphyra AVHNIELRPYCGGQIVRSAGTYAQIVAKEGNFVTVKLPSSEVRMIRKECYATIGQVGNIDASNITLGKAGRSRWLGKRPTVRGVVMNPVDHPHGGGEGKS Arabidopsi PIGRKKPVTPWGYPALGRRTKRKKYSETLILRRRMSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRALKKIQQKTETNPLSVLRQAI Nicotiana PIGRKKPTTPWGYPALGRRSKRNKYSDNLILRRRMSRRGTAEKKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLSVLRQAI Oryza PIGRKKPTTPWGYPALGRRTKRKKYSDSFILRRRMSRRGTAEKRTAKSDPIFRNRLVNMVVNRIMKDGKKSLAYQILYRAVKKIQQKTETNPLLVLRQAI Pinus PIGRKKPVTPWGYSALGKKSKRNRYSDASILRRRMSRRSTAEKKTAKSDPIYHNRLVNMVVNRILKNGKKSLAYRILYRAIKKIQQKTDKNPLSVLRQAI Marchantia PIGRKKPLTPWGHPALGKRSKNNKYSDTLILRRRMSRKSIAEKQVAKPDPIYRNRLVNMLVNRILKNGKKSLAYRILYKAMKNIKQKTKKNPLFVLRQAV Nephroselm PIGHPGPLTPWGKPALGQRTARKKYSDALLVRRRMSRRNTAVKRSISSDPVYNSQLIHMMISHILKEGKKALAYRLMYDAMKRIEKTTQQDPILVVERAV Chlorella PIGRARPVSPWGRPALGAKTKRKKFSAALILQRRMSRRRTQKKRIVMPDPVYDSRLVELLVRQLMREGKKSLAYRICYESMNRVADATQQDPLVIVEQAI Chlamydomo PIGRSRPVTPWGRPALGQLTKPKKYSNTLIVKKRMPRRPINKKRTLLPDPVYNSVSVHMLVNRVLKSGKKSVAYRIVYNALKEIGDVTQKNPVEVFEKAL Mesostigma PIGRPKPVSPWGKTALGAKTKRKKYSDVLIIRRRMSRRSTPKKRIIDSDPIYRSRLVTMLISHILKEGKKSLAQKIFYQAMKNIEEKTEKDPLKVLQQAV Cyanophora PIGRSTPVTPWGKPALGRRTRTKKYSDNLIIRRRMSRRSTAKKRLILPDPIYNSRLVTLLINHMLKDGKKSIARSFIYEALKIIEEKKGSDPLEVLEQAV Cyanidium PIGRSQPSTPWGRPALGIKTRRNKFSNFYILRRRMSQKDPYKTYRLVSDPFYESPLVTLLIMHVLRNGKKSISQRIVYSAIENIAMKVKEDPLEIIERAI Odontella PIGRTRPLTPWGKPALGIKTKNKKASDAYILRRRMSRRNISKKRFPEADSTYNSYLVSLLITRILKSGKKNLAQNIVNAAFEIIKVKTNEDPLVVFERAI Guillardia PIGRAKPVTPWGKPALGVKTRQNKYSDFCIIRSRMSRRSTTKKKLALPDPIYNSRLVNMLTVRILKEGKKHLAQRIIYNAFDIIKQRTGEDAILVFESAI Porphyra PIGRSRPVTPWGKPALGVKTNPNKYSNPYVLLVVMSRRNTAKKRFASPDPLYKSRLVSMLTVRILKSGKKTLAQRIIYQALDIVKERTETDPLNVLEKAI Arabidopsi RGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRAEANRAFAHSLIIYIITWASSSA Nicotiana RGVTPDITVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRAEANRAFAHSLMIYILTRTSSSA Oryza RRVTPNIGVKTRRKKGSTRKVPIEIGSKQGRALAIRWLLEASQKRPGRNMAFKLSSELVDAAKGGGGAIRKKEATHRAEANRALAHSIMIYVITRTSSNA Pinus RRVTPNVTVKARRVGGSTYRVPTEIRSTQGKVLAIRWLLGASRKRPGRNMNFKLSHELMDAARGNGNAIRKKEETHRAEANRAFAHLVMIHIITRTSSNA Marchantia RKVTPNVTVKARRIDGSTYQVPLEIKSTQGKALAIRWLLGASRKRSGQNMAFKLSYELIDAARDNGIAIRKKEETHKAEANRAFAHMIIINTIFWSSSEA Nephroselm RNATPTIEVKARRMGGSIYQVPLEVKPERGTALALRWILLAARNRTGRDMVAKLSNELMDASNRIGNAVRKRDEMHRAEANKAFAHLALSWSPFGPAVQA Chlorella RNATPLVEVKARRIGGSTYQVPLEVASERGTALAIRWILSVCRKKTGRPMAAKLTAELLDAAKNSGLAVRKRDEIHKADANKAFAKLVLVCSFFLTASNA Chlamydomo DNVTPRVEVKPRRRAGAIQMVPRVLRLGDRARANLRWIMEACDKRSGQPMVTKLKSEILDAYKKTGFAIRKKEELHKAIANAMYAKILGMAGGLAVSAQA Mesostigma LNATPLVEVKARRLGGSTYQVPREVKAERGTALALRWLLSSARQRPGRNMVAKLTNEIVDAANETGNAIRKREETHRAEANKAFSHFLIIGTIFMPLSEA Cyanophora RNSTPLIEVKARRIGGSTYQVPMEVRVDRGITLALRVVNSFSLQRLGKTIAVKLANELIDAANETGNTIKKREEMHRAEANKAFVHSLLLNLVAQPTCQA Cyanidium KNVIPAVEIRSRRIGGSTYQVPTEVRVHRGISLSIRWVIKFAKIRPGKSMSLKLANELLDASKNLGNSIRKKEDTHKAEANRAFAHTLCIICLYQANSNS Odontella RNASPVVEVKARRIGGSTYQVPVEVSGFRATNLSLRWIIQYSRQRVGRTMSIKLANEIIDTANDIGNTIKKKEETHKANANKAFAHAISLFGLSIENSSA Guillardia KKVTPLVEVKARRIGGSTYQVPMEVRAFRGTNLALRWITKYARERAGKSMSMKLANEIMDAANETGSSIRKREEIHRAEANKAFAHSLILSVCFYSIAQA Porphyra RNITPLVEVKARRVGGSTYQVPIEVRAYRGTNLALRWITRFSRERSGKSMSMKLANEIMDAANETGNSIRKREETHRAEANKAFAHTILNIICIAPNSNA Arabidopsi YPIFAQQNYENPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQVLANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNL Nicotiana YPIFAQQGYENPREATGRIVCANCHLANKPVEIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKRGGLNVGAVLILPEGFELAPPDRISPEMKEKIGNL Oryza YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQVLANGKKGGLNVGAVLILPEGFELAPPDRISPELKEKIGNL Pinus YPIFAQQGYENPREATGRIVCANCHLAKKPVDIEVPQSVLPNTVFEAVVKIPYDMQMKQVLANGKKGALNVGAVLILPEGFELAPPDRISPEIRQKTGNL Marchantia FPIYAQQGYENPREATGRIVCANCHLAKKPVDIEVPQSVLPNTVFEAVVKIPYDMQIKQVLANGKKGSLNVGAVLILPEGFELAPSDRIPPEMKEKIGNL Nephroselm YPIYAQENYAYPREATGRIVCANCHLAQKPVDIEVPQAVLPDTVFEATVKIPYDTEAKQVLGTGKKGPLNVGAVLILPEGFQIAPTDRIPEEMQTKVGKL Chlorella YPIFAQQNYANPREANGRIVCANCHLAEKPIEIEVPQAVLPDTVFEAVVKIPYDKQIKQVLANGKKGDLNVGAVLILPDGFEIAPPDRIPEEMKAKVGKL Chlamydomo YPVFAQQNYANPREANGRIVCANCHLAQKAVEIEVPQAVLPDTVFEAVIELPYDKQVKQVLANGKKGDLNVGMVLILPEGFELAPPDRVPAEIKEKVGNL Mesostigma YPIFAQQNYASPREATGRIVCANCHLAKKPVDIEVPQAVLPDTVFEAVVKIPYDTQVQQVLGNGKKGPLNVGAVLILPEGFKLAPQDRIPEEMKSKISNL Cyanophora FPIYAQQAYQIPREATGRIVCANCHLGKKPVEIEVPQAVLPNTVFEAVVKIPIDKGAQQIQANGQKGPLNVGAVLMLPEGFKLAPAERLSEELKAKTAGL Cyanidium YPIYAQQTYENPRESTGRIVCANCHLAQKNIYIEAPKEVLPNTVFETVVKIPYEFNKKQILGNGSKGDLNVGAVVILPEGFKLAPKDRMDEKLLKKTKNL Odontella YPVFAQQGYSNPRAANGKLACANCHLNQKAIEIEAPQAVLPNSVFEVTVKVPYDTTRQQVGANGKKADLNVGGIVILPKGFKLAAKNQIPAEVKAKNKGV Guillardia FPVFAQQAYENPREATGRIVCANCHLAQKPVEIEVPQAVLPDTVFEAVVEVPYDLSLQQVTGNGTKGPLNVGAVVILPEGFTLAPKDRISSELKEKTKGL Porphyra FPIYAQQAYESPREATGRIVCANCHLAQKPVEIEAPQAVLPNTVFETVVKIPYDNNAKQILGNGSKGGLNVGAVVILPEGFKLAPANRLSPELKEKTKNL Arabidopsi SFQNYRPNKKNILVIGPVPGQKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIISKILRKEGGYEITIVDAREVI Nicotiana SFQSYRPNKKNILVIGPVPGQKYSEITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRKEGGYEITITDARQVV Oryza SFQSYRPNKKNILVIGPVPGKKYSEIVFPILSPDPAMKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGVVRKILRKEGGYEISIVDARQVI Pinus YFQNYRPNKKNIIVIGPVPGQKYSELVFPILSPDPSTDKEAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYSASATGRVSKILRKEGGYEITIDNTGQVV Marchantia FFQPYSNDKKNILVIGPVPGKKYSEMVFPILSPDPATNKEAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNASITGKVSKIFRKEGGYEITIDDIHKVV Nephroselm YFQQYSPEHPNVIVVGPLPGKKYNEMVFPILAPNPATNKDVHFLKYPIYLGGNRGRGQVYPDGSKSNNNIFQAPVAGTITSITPGEKLTRVTLKTVTEVV Chlorella YFQPYSAEKKTIFVVGPVPGKKYSEMVFPILSPDPAKTKSISYLKYPIYVGGNRGRGQVYPDGSKSNNTIFTASAAGKITAIEPAGGGYTLTIETAESIS Chlamydomo YYQPYSPEQKNILVVGPVPGKKYSEMVVPILSPDPAKNKNVSYLKYPIYFGGNRGRGQVYPDGKKSNNTIYNASAAGKIVAITALSGGFEVSIEKAEVVV Mesostigma YFQPYNAANENILVIGPIPGDKNREIVFPILSPDPAKDKGTYFIKYPISVGANRGRGQVYPDGSKSNNTVYNASVSGTITDIIKEKKAYKISIETKGTVV Cyanophora YFQPYSADKENILVIGPIPGDKNQEIIFPILSPNPETNKNVKYLKYQLHVGGNRGRGQVSPTGEKTNNTIYNASVNGRISEITKLEGGYEITITTKESKI Cyanidium YFNNYSQKLDNIIVIGPITGKDNQEITFPILAPDPQINKNTHFLKYSIYVGANKGRGQLYPSGEKSNNNPIPSNAEGRIEKIKPNEGGYEVIIKTKETIS Odontella FISPYSTEFDNILIVGPIAGKTHQELIFPVVSPDPEKDSDVKYLTYPLYAGGNRGRGQVYPTGEKSNINSFGAVQAGQISEITTSEGESNITIINSVKTS Guillardia IITPYNEANPNILVVGPVPGKDHQKLVFPVLSPNPAENKNVHFIKYPVYVGANRGRGQVNPTGEKSNNTVYTSPIDGQIVKLEKSDNVTSFSIKSKDIIT Porphyra YIQPYSTKQSNILVIGPIPGDKNREIIFPILSPDPAKDKQAHFFKYPIYVGGNRGRGQIYPTGDKSNNNLISASASGKINKIEALEGGFIVHITSTSEVN Arabidopsi DIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNFMSHSVKIYDTCIGCTQCVR Nicotiana DIIPPGPELLVSEGESIKFDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNFMSHSVKIYDTCIGCTQCVR Oryza DLIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNFMSHSVKIYDTCIGCTQCVR Pinus DIVPPGPELLISEGELIKVDQPLTNNPNLGGFGQGDAEIVLQDPLRVKGLLLFLASVILAQIFLVLKKKQFEKVQLAEMNLMAHSVKIYDTCIGCTQCVR Marchantia DISAAGPELIISEGELVKVDQPLTNNPNVGGFGQGDAEVVLQDPLRIQGLLLFFGSVILAQIFLVLKKKQFEKVQLAEMNFMAHAVKIYDTCIGCTQCVR Nephroselm ESIPAGPDIIVSVGQTVKADQPLTNNPNVGGFGQAETEVVLQNPARVQGLIIFFAFVLIAQVFLVLKKKQFEKVQLSEMNFMSHSVKIYDTCIGCTQCVR Chlorella EKLPPGPELVVNIGDIVGVDQALTTNPNVGGFGQGETEVVLQNPLRIQGLLVFFLFVLLAQVFLVLKKKQFEKVQLAEMNFMSHTVKIYDTCIGCTQCVR Chlamydomo DKIPAGPDLIVKEGQTVQADQPLTNNPNVGGFGQAETEIVLQNPARIQGLLVFFSFVLLTQVLLVLKKKQFEKVQLAEMNFMAHIVKIYDTCIGCTQCVR Mesostigma DTVPVGPELIVAKGDTVVTGQPITDNPNVGGFGQMDTEVVLQNPVRIKWLIAFLILSTLGQVFLVLKKKQFERVQIAESNFMAHSVKIYATCIGCTQCVR Cyanophora ETIPAGPSLVVKKGQTIKADQPLTIDPNVGGFGQMDTEIVLQSAGRVQGLIAFFISVVLAQIFLVLKKKQFEKVQAAEMNFMAHTVKIYDTCIGCTQCVR Cyanidium QYVPIGLNLTIKEGQRIKAGEYITTDPNVGGFGQSEIEIVLQNPTRLISFIFFSISVLISQLFFVLKKKQFEKVQSLNQNFMVHVVKIYDTCIGCTQCVR Odontella QIIPAGLTLTVKQGDSVKVDQSLNIDPNVGGFGQEETEIVLQNPLRIIGYLGFCFCVLLTQVLLIIKKKQFEKVQAAELNFMSHTVKIYDTCIGCTQCVR Guillardia VKVPFGPDILVKEGQTLVADQQLTNDPNVGGFGQVETEIVLQSPARVKGLIAFFFTVILAQILLVLKKKQFEKVQLAEMNFMSHSVKVYDTCIGCTQCVR Porphyra QSIPAGVELKVREGETIQLDQAISKDPNVGGFGQNETEIVLQSPNRIKGMIAFFFVSVLAQIFFVLKKKQFEKVQAAEMNFMAHSVKVYDTCIGCTQCVR Arabidopsi ACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAYLKTYLSVAPVLSTLWFGSLAGLLIEINRLFPDALTFPF Nicotiana ACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAYLKTYLSVAPVLSTLWFGALAGLLIEINRFFPDALTFPF Oryza ACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLGPETTRSMALSYIKTYLSVAPVVSTLWFGALRGLLIEINRLFPDALSFPF Pinus ACPTDVLEMIPWEGCKAKQIASAPRTEDCAGCKRCESACPTDFLSVRVYLWHETTRSMGLAYLKTYLSTAPVLAILCVSFLAALLIEINRFFPDALFLSL Marchantia ACPTDVLEMIPWDGCKANQIASAPRTEDCVGCKRCESRCPTDFLSVRVYLGNETTRSMGLSYVKTYLSTAPVLATLWFGFLAGLLIEINRFFPDALVLPF Nephroselm ACPTDVLEMVPWGGCKAAQIASAPRTEDCVGCKRCESACPTDFLSVRVYLGAETTRSMGLAYFTTYLSTAPVLAAVWFGFLAGLLIEINRFFPDALSFSF Chlorella ACPTDVLEMVPWDGCKASQIASAPRTEDCVGCKRCESACPTDFLSVRVYLGSETTRSMGLAYFTTYLSTAPVLTLVSLTAVAGLLIEINRFFPDALTAAF Chlamydomo ACPLDVLEMVPWDGCKASQMASAPRTEDCVGCKRCETACPTDFLSVRVYLGSESTRSMGLSYFTTYLSTAPVIATIWFTFTAGLLIEINRYFPDPLVFSF Mesostigma ACPTDVLEMVPWDGCKANQIASAPRTEDCVGCKRCESACPTDFLSVRVYLGNESTRSMGLAYFQKYLSTAPVLATIWFIILAGLLIEINRFFPDALLVPM Cyanophora ACPTDVLEMVPWDGCRANQIASAPRTEDCVGCKRCESACPTDFLSIRVYLGAETTRSMGLGYFSKYLSTAPVIGTLTAFFLAGLLIEINRFNPDLLVYPF Cyanidium ACPCDVLEMVPWDGCKASQIASSPRTEDCIGCKRCETACPTDFLSIRVYLGAETSRSMGLTYLLKYIYTVPVISTLWLLLTAGILIEINRFYPDALFYAF Odontella ACPTDVLEMVPWDGCKSGQIASSPRVEDCVGCKRCETACPTDFLSVRVYLGLETTRSLGLAYLQKYLSTAPVLLTLWMTFTAGFIIEINRFFPDMLGLYF Guillardia ACPCDVLEMVAWDGCKAGQIASAPRTEDCIGCKRCETACPTDFLSVRVYLGGETTRSMGLAYFLKYLSTAPVLLTIWLSFTAALVIEANRFYPDMLYFPI Porphyra ACPCDVLEMVPWDGCKAKQIASAPRTEDCIGCKRCETACPTDFLSVRVYLGAETTRSMGLAYFTKYLSTAPVIGVLWMTFTAGFIIELNRFFPDVLYFYL Arabidopsi MARSTTVGKLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLLDGISVNLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGEEMETAT Nicotiana MARRTAVGDLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLLDGISMNLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGEEMETAT Oryza MARQTRVGNLLKPLNSEYGKVAPGWGTTPFMGVAMALFAVFLSIILEIYNSSVLLDGILMNLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGDEMETAT Pinus MAKETLVGTTLKPLNSEYGKVAPGWGTTPLMGFAMALFAVFLSIILEIYNSSVLLDGIPVSLTLKLFVYAVVVFFISLFIFGFLSNDPGRNPGKEMETAT Marchantia MAKKSGIGDILKPLNSEYGKVAPGWGTTPLMGIMMALFAVFLVVILELYNSSVLLDGVSVSLTLKLFVYTVVIFFVSLFVFGFLSNDPGRNPGKEMETAT Nephroselm MAKITPLGTALKPLNSEYGKVAPGWGTTPVMGLFMALFAVFLLIILEIYNSSLILDDVGVSLTLKIFVYTVVTFFVSLFIFGFLSNDPGRNPGKDMETAL Chlorella MAVSTPLGTLLKPLNSEYGKVAPGWGTTVLMGIFMALFAVFLVIILEIYNSSVLLDDVTMSLTLKIFVYTVVTFFVSLFIFGFLSNDPGRNPGREMDSAF Chlamydomo MALVTPLGTLLRPLNSEAGKVLPGWGTTVLMAVFILLFAAFLLIILEIYNSSLILDDVSMSLTLKIFVYTVVTFFVCLFIFGFLSNDPARNPGKNMESAF Mesostigma MAKRTVVGNFLKPLNSEYGKVAPGWGTTVLMGVFMALFAVFLVIILQIYNASVLLDGIPANLTLKIFVYTVVIFFVSLFIFGFLSSDTGRNPKKDMETAT Cyanophora MPQRTALGNILRPLNSEYGKVAPGWGTTPLMAVFMLLFFVFLLIIIQIYNSSLLLENVQVSLTLKIVVYTVVIFFVSLFIFGFLSNDPARKPSKDMEIST Cyanidium MALKTRLGELLRPLNSQYGKVAPGWGTTPIMGIFMALFLLFLIIILQIYNSSLILENLDISFTLKIFVYSCVAFFCSLFIFGFLSNDPSRNPNKDMEKAL Odontella MALRTRLGEILRPLNAEYGKVAPGWGTTPIMGVVMLAFLVFLLIILQIYNSSLIIENVDVDLTLKILVYTTVIFFVSLFIFGFLSSDPSRNPNKDMETAT Guillardia MALRTRLGELLRPLNSEYGKVAPGWGTTPAMGFVMLLFFLFLLIILQIYNSSLILENVDVDFTLKIVVYTTVTFFVSLFTFGFLSNDASRNPNKDMETAT Porphyra MALRTRLGEILRPLNSEYGKVAPGWGTTPIMGIFMLLFFLFLLIILQIYNSSLVLENVDVDFTLKIFVYTTVIFFISLFVFGFLSNDPSRNPNKDMETAT Arabidopsi LVAIFISGLLVSFTGYALYTAFGQPSQQLRDPFEEHGDMEALVYTFLLVSTLGIIFFAIFFREPPKISTMIQPQTYLNVADNSGARELMCIRIIGNRRYA Nicotiana LVAIFISGLLVSFTGYALYTAFGQPSQQLRDPFEEHGDMEALVYTFLLVSTLGIIFFAIFFREPPKVPTMIQPQTHLNVADNSGARELMCIRIIGNRRYA Oryza LVAISISGLLVSFTGYALYTAFGQPSQQLRDPFEEHGDMEALVYTFLLVSTLGIIFFAIFFREPPKVPTMIQPQTLLNVADNSGARKLMCIRVIGNQRYA Pinus LVTISISCLLVSFTGYALYTAFGQPSKQLRDPFEDHEDMEALVYTFLLVSTLGIIFFAIFFREPPKLPTMIQSQTYLNIADNSGARKIMCIRVLGNRKCA Marchantia FVAIFISCLLISFTGYALYTAFGQPSNELRDPFEEHEDMEALVYTFLLVGTLGIIFFAIFFREPPKVPSMIQPQTYLNVADNSGARKLMCIRVIGNRKYA Nephroselm VATVFVSCLVLSITGYSLYIGFGPPSKELRDPFDEHEDMEALVYTFLLISTLGIIFFGIFFREPPRIVKMIQPQTILQVADNSGARQLMCIRVLGRKRYA Chlorella FFTIFLWCLLLSITGYSIYVGFGPPSQQLRDPFEEHEDMEALVYTFLLVGTLGIIFFAIFFREPPRIVKMIQPQTYLRVADNTGARELMCIRVLGKQRAA Chlamydomo FFTFFLWFLLLSVTGYSVYVSFGPPSKKLRDPFEEHEDMEALVYTFLLVGTLGIIFFSIFFRVPPRMIKMIKPLSYLNVADNSGARELMCIRALGYRESA Mesostigma IFSIFFSCLLIGLTGYSLYTSFGNASSELRDPFEEHEDMEALVYTFLLVGTLGIIFFAIFFREPPRIIKMIQAQSYLNVADNSGAKKIMCIRVLGQRKYA Cyanophora FLSIFISAALLGITGYSIYTAFGPPSKNLRDPFEEHEDMEALVYTFLLVTTLGILFFSIIFRDPPRINQMIQPQSYLTAADNSGARKLMCIRVLGNRRYA Cyanidium ILSIFIFSLLLGITSYSIYISFGPLSKTLRDPFEEHEEMEALVYVFLLIGTLVVIFFAIFFRDPPRIAKMISVHTRLKVIDNSGGKEIMCIRVLGNRKYA Odontella IIVIFVSSLLLGITAYSIYTAFGPAAKNLRDPFEEHEDMEALVYTFLLIGTLMVIFFAVFFRETPRILRMIYPQTMLTVADNTGARKIMCIRVLGNRKYA Guillardia VLIIFIASLLLGLTGYSIYTAFGPNSKELRDPFDDHEDMETLVYTFLLIGTLAVLFAAVFFRDPPRIAKMIQTQTYLTVADNSGAKKIMCIRILGNRKYA Porphyra VLSIFISSLLLGITGYSIYTAFGPASKDLRDPFEEHEEMEALVYVFLLTGTLMVIFFAIFFREPPRIAKMIQTQSYLNVADNSGARKIMCIRVLGNPSYA Arabidopsi HIGDVIVAVIKEAIPNTPLERSEVIRAVIVRTCKELKRNNGTIIRYDDNAAVVIDQEGNPKGTRVFGAIPRELRQLNFTKIVSLAPEVLMTRIKRGYIAR Nicotiana HIGDVIVAVIKEAVPNMPLERSEVVRAVIVRTCKELKRDNGMIIRYDDNAAVVIDQEGKSKGTRIFGAIARELRELNFTKIVSLAPEVLMTRIKRGYIAR Oryza RIGDVIVAVIKDAVPQMPLERSEVIRAVIVRTCKEFKCEDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEELRELNFTKIVSLAPEVLMTRVPRGYIAR Pinus HIGDVIIAIIKEAVPNMPLEKSEVVRAVVIRTCKEFERDNGMMIRSDDNAAVVIDQEGNPKGTRVFGPVAQELRQLNFTKIVSLAPEVLMTRVKRGYIAR Marchantia NIGDIIIAVVKEAVPNMPIKKSEIVRAVIVRTCKEFKRNNGSIIKFDDNAAVVINQEGNPKGTRVFGPIARELRESNFTKIVSLAPEVLMTRVKRGYVAR Nephroselm SIGDVIIAVVKDAIPNMPVKKSDVVRAVVVRTSKPVRRDTGMLIRFDDNAAVIVNQEGNPRGTRVFGPVARELRDRQFMKIISLAPEVLMTRVKRGYVAR Chlorella TVGDIIIAVVKDATPNMPVKRSDIVRAVIVRTRKNVRRVNGTSIRFDENAAVIINKENNPRGTRVFGPVARELRDGNFTKIISLAPEVLMTRVKRGNVAR Chlamydomo NIGDVIIAVVKDALPNMPVKRSDIVRAVIVRTRKGIRRENGMAIRFDDNAAVIINKEGNPRGTRVFGPIARELRDKNFTKIVSLAPEVLMTRVKRGNVSR Mesostigma AIGDVIIGVVKDSVPNMSLKKSEVVRAVVVRTCKGIRRENGMTIRFDDNAAVVINKDGNPKGTRVFGPVARELRDRNFTKIVSLAPEVLMTRVKRGNVAR Cyanophora RIGDVIVAVVKDGIPNIPIKKSDTVKAVIVRTRKELKRDNGMNICFDDNAAVIINADGNPRGTRVFGPVARELRDKNFTKIISLAPEVLMTRVKRGNVAR Cyanidium TLGDVIIGVVKNAVPNMPVKKSDVVRAVVVRIKKTINRKNFFSVRFDDNAAVIIGSDGNPKGTRIFGPVARELRDKNFSKIASLAQEVVMVRVKRGNVAR Odontella KIGDTIIGVVKEAIPNMPIKRSDIVRAIVVRTSKTIRRPDGMYIRFDDNAAVIVNLDNNPRGTRVFGPVAREIRDKNFSKIVSLAPEVLMARVKRGNIAR Guillardia SIGDVIIGVVKDATPNMPVKRSDVVRAVIMRTKNTIRRKDGMSIRFDDNAAVIINKENNPRGTRVFGPIARELRDKDFTKIVSLAPEVLMVRIKRGNIAR Porphyra SIGDVIIGVVKDASPNMPVKRSDVVRAVVVRTRKALRRNDGMSIRFDDNAAVIINQDNNPRGTRVFGPIARELRDKNFSKIISLAPEVVMSRVKRGNVAK Arabidopsi RRRTKLRLFASSFRGAHSRLTRTMTQQRIRALVSAHRDRGKRKRDFRRLWITRINAVIYNEFIHNLYKKQLLLNRKILAQIALLNRSCLYTISNDFHNKV Nicotiana RRRTKIRLFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRKKRDFRRLWITRINAVIYSRLIHDLYKRQLLLNRKILAQIAISNRNCLYMISNEFHNKA Oryza RRRAKMRSFASNFRGAHLRLNRMITQQVRRAFVSSHRDRVRQKRDFRRLWISRINAATYSKLIHNLYKKELILNRKILAQVAVLNSNNLYTISNKFQNKE Pinus KRRKKILAFVSGSRGAHSKLFRTANQRKARALVSAHRDRGKRKRDLRRLWITRINAAAYNRFIQYLYKRQLLPNRKTLAQIAVLDSNCFSTIFNNFYNKV Marchantia KRRKNILTLTSGFQGTHSKLFRTANQQGMRALASSHRDRGKRKRNLRRLWITRVNAAAYNKLIEYLYKKKILLNRKILAQIAILDKFCFSTIIKNFYNKV Nephroselm KRRNKILRANRSFRGTHSKLFRIANQQHMKALRYSYRDRACKKRDFRHLWITRINAVVYSRFMHQLRLGNMVLNRKVLSQLASLDPASFNRLIRAFFNRT Chlorella KRRKQVLNLASGFRGSSSRLFRTAQQQTMKALSYSYRDRQQKKREFCGLWVTRLNAAAYTNFRHNLKKAGIQLNRKVLSQVALRDKQAFEQLILLFFNVS Chlamydomo KRHKKILNMSKGFRGAASTLFRTANQQNMKALRYSYRNRRQKKRDFRRMWITRVNSAVYSEFMNYLKTHKIQLNRKVIAQLSICDPEAFMQLLLFYVNSA Mesostigma KHRNKILNLAKGFRGAHSVLFRTANQQIIKSLRYAYRDRARKKRDFRKLWIARINAASYSQLINQLKTSNILLNRKILAQIALLDGPVFSQIVMEFCNRI Cyanophora KRRKKILKLASGFRGAHSRLFRVANQQVMKALRYAYNDRNKRKRDFRALWIARINASAYSKLMGSLKKLNIILNRKSLSQLAIYDKDAFMEILKTFFNQT Cyanidium KRRKKILKLASGFKGAHSKLFRVANQQVNKSLRYSYVGRKLKKRRFRRLWILRLNAASYSKLVNSLKLLRIQLNRKSLSQLAMIDNDAFKRLVASFLNRI Odontella KRAKKILQLAKGYRGAHSRLFRIANQQVMKALRYSYVGRKQKKRVFRKLWITRINAASYSRLIHNFKKSNIELNRKMLSQIAVLDIPTFNQLIAIYQNTL Guillardia KRHKKILKLAKGFRGSHSKLFRIANQQVMKALRYGYHGRKRRKREFRSLWITRINAAVYSCFINSLKRQHIALNRKMLAQLAVSDQNAFKQLTKIFTNKV Porphyra KRRAKVFKLAKGFKGAHNSLFRTAKQQVLKALRYSYVGRKRKKRDFRRLWITRINAAAYSTFITALKKDNIALNRKMLAQLASNDIKAFQAILETFSNKV Arabidopsi IDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTISKGWLVGNVHAVEKLRQSIEIWYATSEYLRQEMNPNHMMSFSGARGNA Nicotiana INGTAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTISKGWLVGNVHAVEKLRQSIEIWYATSEYLRQEMNPNHIMSFSGARGNA Oryza IDGTAMKRLISRLIDHFGMGYTSHILDQIKTLGFHQATTTSISLGIEDLLTISKGWLVGAVHAVEKLRQSVEIWYATSEYLKHEMNSNYLMSFSGARGNA Pinus MDKTAIKKLISRLIDHFGMTYTSHILDQLKTSGFQQATDTAISLGIDDLLTASKGWLVGNVHAVEKLRQSIEIWYATSEYLRKEMNPNHVMSFSGARGST Marchantia MDRTAIKQLISRLIAHFGITYTTHILDQLKTLGFQQATFGAISLGIDDLLTASKSWLIGSLHAVEKLRQLIETWYATSEYLKQEMNPNHMMSFSGARGST Nephroselm ADKGMIKRLIAWFLVHYGLADTVSMIEDLKQVGFQYATRAGISLGIEDLRIPTKPRLLGYVSLVERFQKVIDTWNGTSELLKDDVVENYMMAFSGARGNL Chlorella FDKNTLKTVIAWFLDQYGGKATVDLVETLKQVGFHQATRAGVSLGLEDLQIPQKASFLGNLTSVEKSQRLIDTWNKTSESLRQAAVHNYMMAFSGARGNI Chlamydomo ISKEENMDGSSTQMSAHSLPKRQRKGAKVSKINFKTSKIMRIKHSFNSLRVDKRKRNLSSVTHVNKYKRSIRLQNTTTKKAKVPFTGYLKLAQSGTKAIL Mesostigma MNKGEIRRIIAWFLFNHGTSRTAHMVDRLKILGFYHATKAGISLSIDDLSIPTKKWLLGKITAVERFQKVIDTWHSTSETLKNEVVQYYMMAFSGARGNL Cyanophora IGKKEVKNVIAWAFTSYGAARTAYLVEQLKDLGFHYATKAGISLSVEDLLIPLKDSLLGEITEVERFQKVIDIWHRTSETLKDEVVDYYMMSFSGARGNL Cyanidium IEKSELREIIEVVFHKNGIAKASLIADNLKEIGFGFATKAGISISIEDLKIPNKSRILAEITTIEKSQKSTDTWNNASEALKDEIIKYYMMAFSGARGNL Odontella ISKKQLKQLLSWSFTTYDSMQACSLADELKYLGFKYASKAGISISIEDLKVPNKNLLLGKLTDVERFQKLIDTWNLTSESLKDELVSYYIMAFSGARGNL Guillardia IDKKELKKLMAWAFSNYGTGRASFMADKIKDLGFHYATKAGLSLSVEDLRVPIKRDLLGEITTIERFQKVIDTWNNTSEQLKDEVIKYYIMAFSGARGNI Porphyra IDKNQLKNLIVWAFRNYGIARAANMADKLKDLGFHYATQAGISLSLEDLRIPSKKSLLGEITTVERFQKVIDTWNNASESLKQEVIEYYMMAFSGARGNI Arabidopsi SQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGARKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNQTLIGRVL Nicotiana SQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGARKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTARGISVSPRNQTLIGRVL Oryza SQVHQLVGMRGLMADPQGQMIDLPIQSNLREGLSLTEYIISCYGARKGVVDTAVRTADAGYLTRRLVEVVQHIIVRRRDCGTIQAISVSPQNQTLIGRVL Pinus SQVHQLVGMRGLMSDPQGQIIDLPIRRNLREGLSLTEYIISCYGARKGVVDTAVRTADAGYLTRRLVEVVQHIVVRRTDCGTIQGIFVSPIRRTLIGRVL Marchantia SQVHQLVGMRGLMSDPQGQIIDLPIQSNFREGLSLTEYIISCYGARKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRKVDCGTLYGINVNNLSQKLIGRVI Nephroselm SQVRQLVGMRGLMSNPQGEIIDLPIRSNFREGLTVTEYIISCYGARKGLVDTALRTANSGYLTRRLVDVAQDIVIRMTSCSPSAYPLISFTKLELLGRVL Chlorella SQVRQLVAMRGLMADPQGAILEFPIQSNFREGLTITEYLLSCYGARKGLVDTALRTASAGYLTRRLVDAVQHVVIYTKNCKTEKGITFKGLHIELLGRVL Chlamydomo KHFKSLKAVKGFLNTSLGDKQALYFKTKTEANLQLLTLVLENFYRKKTILNKNLKLKKNHYYNKLSVQKPNAIFLLTHMLAKANKIQISYSYLDNLTTTN Mesostigma SQVSQLVGMRGLMSDPQGQIIDLPIRSNFREGLTVTEYVISCYGARKGLVDTALRTADSGYLTRRLVDVAQDMIIRETDCGTKSGILLGPVKLQLIGRVL Cyanophora SQVHQLVGMRGLMADPQGEIIDFPIRSNFKEGLTTTEYLISSYGARKGVVDTALRTADSGYLTRRLVDIAQEVIIREIDCETPRGVILTALKLKLVGRVL Cyanidium SQVKQLVGMRGLMADPNGQIIELPILSNFREGLNVTEYLISSYGARKGLVDTSLRTADSGYLTRRLVDVAQDIIVREIDCKTNNGITFSNIQLYLIGRIL Odontella SQVRQLVGMRGLMSDPSGELLKLPIKKNFREGLTITDYLMSGYGARKGIIDTALKTANSGYLTRRLIDVAQDIIIREKDCLTKHSCLIINFEVYILGRLL Guillardia SQVRQLVGMRGLMADPQGQIIDLPIKSNFREGLTVTEYLISSYGARKGLVDTALRTADSGYLTRRLVDVAQDIIIREIDCGTQRGIVLRDMVLKLIGRVL Porphyra SQVRQLVGMRGLMADPQGQIIDLPISSNSREGLTVTDYFISSYGARKGLVDTALRTADSGYLTRRLVDVSQDVIIREVDCKTKKGIILEDLVLELAGRVL Arabidopsi ADDIYIVAFRNQDLGIGLVNRLQSISIRTPFTCRSTSWICRLCYGRSPTHGDLVELGEAVGIIAGQSIGEPGTQLTLRTFHTGGVFTGGTAEHVRAPYNG Nicotiana ADDIYMIATRNQDIGIGLVNRFQPISIRTPFTCRSTSWICRLCYGRSPTHGDLVELGEAVGIIAGQSIGEPGTQLTLRTFHTGGVFTGGTAEHVRAPSNG Oryza ANDIYIIATRNQDIGIGLVNRFQPIYIRTPFTCRSTSWICQLCYGRSSTHGDLVELGEAVGVIAGQSIGEPGTQLTLRTFHTGGVFTGGTADLVRSPSNG Pinus ADDVYIIATRNQDIGVGLANQLQPIYIRTPFTCKSISRICQLCYGRSTTHSHLIELGEAVGIIAGQSIGEPGTQLTLRTFHTGGVFTGDIAEHIRAPFNG Marchantia AENIYIIAPRNQDIGALLANRLKQIFLRSPLTCKSMNWICQLCYGWSLSHGNLIEMGEAVGIIAGQSIGEPGTQLTLRTFHTGGVFTGDIAEHVRTPFNG Nephroselm AIGAFNISGPDTAISQEIAVQLKEILVRSVLLCKSKRGLCRLCYGWNLGTGTIVSIGEAVGIIAAQSIGEPGTQLTMRTFHTGGVFAGGVTNEIRAPHAG Chlorella LKDVILVIPKDTLVSSSLAKKLQKIFVRSPLTCQTEKTVCQLCYGLDLAQGKLVCFGEAVGIIAAQSIGEPGTQLTMRTFHTGGVFSEQAMKSFPAPFDG Chlamydomo QKNVASIRNRTRKNNKSSMTKIQFVIILLSLPQNTLGIYDKFNSNFEMAKVTLLTHPLWFNQFQMKSIKEVGNKFIILLLSNNFNFLSIKSEQINLPENK Mesostigma AENIYSIAKKNQDISASLSDKITNILVRSPLTCKSIRSVCQLCYGWSLAHGNLVDLGEAVGIIAAQSIGEPGTQLTMRTFHTGGVFTGNIAKQIRSSIDG Cyanophora LHNLYHIAQKNESISVLLADDIKEVWIRSPLTCKATRSVCQYCYGWNLAHGRLVELGEAVGIIAAQSIGEPGTQLTMRTFHTGGVFTAEVAKQITAPFPG Cyanidium ADDVKNIASKNTLITGNLIKEFQKIKLRSPLTCQSYRSICQKCYGASLSDGKLVDIGEAIGIIAAQSIGEPGTQLTMRTFHTGGVFTAEFSKPIKTLFEG Odontella NKSIYDIAEVNTQVTPNLIRTLKHFYVRSPLTCSLYRSICQKCYGWDLANENLIDIGERIGIIAGQSIGEPGTQLTMRTFHTGGIFTSEIRGTIRSPISG Guillardia FETLYLIGHINQDLDHDITNSIKSVIVRSPLTCEAPRSVCQFCYGWNLAHGSLVDLGEAVGIIAAQSIGEPGTQLTMRTFHTGGVFTGELAEQIRAPFNG Porphyra AENVFHIAHTRQDISPNLAQEIKKVLVRSPVTCNSRSSVCQYCYGWNLAHGRLVDLGEAVGIIAAQSIGEPGTQLAMRTFHTGGVFTGELAEQIYSPIDG Arabidopsi KIKFNDLVHPTRTRHGHPAFLCYIDLSVIIESEDIISVTIPPKSFLLVQNDQYVESEQVIAEIREFKERVRKYIYSDSEGEMHWSTDEFTYSNTSHLWIL Nicotiana KIKFNDLVHPTRTRHGHPAFLCSIDLYVTIESEDILNVNIPPKSLLLVQNDQYVESEQVIAEIRAFKEKVRKHIYSDSDGEMHWSTDEFTYGNTSHLWIL Oryza KIQFNDLVHPTRTRHGQPAFLCYIDLHITIQSQDILSVTIPSKSLILVQNDQYVESEQVIAEIRAFKEKVQKHIYSESDGEMHWSTDEYQYGNTSHLWIL Pinus KIEFNNLVYPTRTRNGHPAYLCHNNLSITIDGQDQVNLTIPPQSLLLVQNDQYVESEQLIAEVRAFKEKVRKNIYSDLEGEMHWSTNEYVQGNTGYLWIL Marchantia IIEFNNFVYPTRTRHGHPAWMCHTNLFLVIKSKNKVNLTIPPKSLLLVQNNQYVESKQVIAEIRAFKEKVQKYIYSNLEGEMHWSTKEYIHSNTCHIWIL Nephroselm LVHYPIHPKWVRTRHGQFGILISEKIEIIFEHESKKIQVFDAGTVLTIHEGEKVHTNQLIGEIPATLVTGWRSLKSGVDGEVRFDELRPRSDRKAHLWIL Chlorella KIEFQLPGRFVRTPYGKIVYLLKHTVSSSLTMRYEIHQDVPAGSLLWVKQGEDVRTGQLLVQGSRKMPESTHIVRTPFSGELFFEHMEKIITRLGRFWVF Chlamydomo KIIFDLQHIVLTEQYKNNLRWVKNKNTLEVNLDPKNLSNLNPTQQLQLSNSEFVKTIKILAKVYSVMSIENCQPSLEVSNTFFLKTQINKTKHKGHLVAY Mesostigma KIIYSTNTIPMRTRHGEIALITQSNINICIQGKNKENIEVPINTILLVNNGSMVRAKQLIAEVSASVEIASKYVASDFSGEIHFENLKSAYGHGGLLWIL Cyanophora RIYYPTTFREIRTRYGDNAWWVENNAKLRLEGEGKRSFNLTQGSIIRIKDQSWVETNDLLAEIASAKEKTTRELRTDIAGEVYFQNLIDEAGGGGSIWIL Cyanidium VIKYPLKFHHVRTRHGDDAIIIEKSATFDIRTTSERKITLETGTTLLVKDNSFIKKNQVIAETSTITEKSTKDLISNSAGEIYFSDIVDRHGNHGLIWIL Odontella IVKFSLKRIPIRTNRGEDVLLTKNAGSLIIIPESKPKLELFRNTVVFHKNNQYIQKNAIIAELVDQTRTEIKPVLTTTSGEVFIPRIINKLDNTKLLWIL Guillardia IIRYPLKIRIIRTRHGNEGVILDENYKLNILNQGEKRLEFKQGTTLFISDNEEFKKGQIIGETKSVTEKATRDLVTETSGEVIYTNLIDRQGNGGLLWIL Porphyra KLTNLLSYMEVRTRHGEQALMTEKPTQVIIESSKQKIINLSKGTTLLVDNNEVVSKDQVIAESPRMIERAQKHVLSDLSGKICFSNLTDNNQYGGLIWVL Arabidopsi SGGSCGSSLAKPYLATPGAKVHGHYSEILYEGDTLVTFIYEKSRSGDITQGLPKVEQVLEVRLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVSEPG Nicotiana LGRPCRSSLAKPYLATPGATVHGHYGETLYEGDTLVTFIYEKSRSGDITQGLPKVEQVLEVRLVNKIQQVYRSQGVQIHNRHLEIIVRQITSKVLVSEPG Oryza SVSMCRSSIAKPYLATTGATVHGHYGEILYKGDRLVTFIYEKARSSDITQGLPKVEQIFEARLVNKIQKVYRSQGVQIHNRHIEIIIRQVTSKVRVSEPG Pinus SGGIYGSRVAKPYLATRKATVHSHYGKILDKGDTLITLIYERFKSSDIIQGLPKVEQLSEARLVNQIQKVYRSQGVRIGDKHIEVIVRQMTSKVLISEPG Marchantia SGNFHKKNNAKPYLATGGATIHNNYGEFIKEGDTLITLIYERLKSGDIIQGLPKVEQLLEARLVDQIQKVYQSQGVQISNKHIEIIVRQMTSKVITLEPG Nephroselm QGHVNTFEMGQPYRVGWQSRLMVTRDQIVKAEKVLAHLLYFKTKTGDIVQGLPKIEEILEARILRRVQLVYRSQGVQISDKHLEIISLRMTSRVLVEKPG Chlorella SSFIQKQTFALPFLGSRRGLVHVAQNDLLQKNHILMTLRSKQLQTEDIVQGIPKIEQLFEARLVKTLLEAYSNQGVNIAEKHVEVVVRQMTARVRITFPG Chlamydomo ARPVFIITNGQPLVISPRSTIHATHGDFIRYKTPVVTLTYQQLKTGDIVQGIPKIEQLFEARIVDGILRVYRSQGVSIADKHVEIVVKQMTSKVRIINPG Mesostigma SGQVYKFSLARPYLVSSEAVLYVDDGDFVKSGDTLVMLIFEQSKTGDIVQGLPRIEELLEARLVNEVQSVYKAQGVHISDKHIEVIVRQMTSKVMIEEPG Cyanophora GGNVYNLSSSRPYLISARAIIRVLTGDLVQSGESLALLVFERAKTGDIIQGLPRIEELLEARLVSEVQSVYQSQGIDISDKHIEIIIKQMTNKVKIEEPN Cyanidium SGEVYNFPMAEPYLISPGTLIHVNHGELIRKGDYLALLVFDKIKTGDIIQGLPRIEEILEARLLKEIQQVYQSQKIEINDKHIEVIIRQMTSKVLIQEPG Odontella SGNVYQAPQTEDYFDEEVNSVFCKNGEFVKNGQTIGLLNFEKEITGDIVQGLPRVEQLLEARILNSVQSVYKSQGVSIADKHLEVIIKQMTTKVLITHPR Guillardia KGDVYNIPYAYPYLVSAGAILQIKDHELVQRNDTLAILVFERSKTGDIVQGLPRIEEILEARLVDEVQKVYQSQNVDISDKHIEVIVRQMTSKVKVEDPG Porphyra SGEVYNIPDARPYLVSNAAILHVDNNALIRKGETLAVLVFDRAKTGDIIQGLPRIEEILEARLVKEVQLVYQSQGVNISDKHIEVIVRQMTSKVKIENPG Arabidopsi ELIGLLRAEYRAVLLGITRASLNTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPAGTGTITPKKPNSALRKVARVRLTSGFEITAYIP Nicotiana ELIGLLRAEYRVVLLGITRASLNTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPVGTGTITPKKPNSALRKVARVRLTSGFEITAYIP Oryza ELIGLLRAEYRAILLGITRVSLNTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGIIPVGTGTINPKKPNSALRKVARVRLTSGFEITAYIP Pinus ELIVLSRAQYQTMLLGITRASLNTQSFISEASFQETARVLAKAALQGRIDWLKGLKENVILGGMIPAGTGTITPKKPNSALRKVARVRLTSGFEITAYIP Marchantia ELIEFSRTQYKPILLGITKASLNTQSFISEASFQETTRVLAKAALKGRIDWLKGLKENVILGGLVPAGTGTTTPKKPNSALRKIARVRLTSGFEITAYIP Nephroselm EIIEKRRADYCPIVLGITKASLTTKGFISSASFQETTRVLTQAVLQGKSDWLLGLKENVILGRLIPAGVGTTTPKKPNSALRKVARVRLSSGFEVTAYIP Chlorella EFIQLRLLEYEPVILGLTKSVLQSESFLLAASFQQVSKVLVRSALATKTDFLRGLMKPLYVASLSQREQETTTPKKPNSALRKVARVRLTSGFEVTAYIP Chlamydomo EIVDIDFVEYEPIVLGITRASLEVESFLSAASFQQTTRVLSQAALYKKKDFLKGLKENIIIGNLIPAGTGTVTPKKPNSALRKVARVRLTTGFEVTAYIP Mesostigma ELIELHRIEYKPIVLGITKASLNTESFISAASFQETTRVLTKAAIEGKTDWLRGLKENVIIGRLIPAGTGTTTPKKPNSALRKVARVRLTSGFEVTAYIP Cyanophora ELIEFQQIEYTPILLGITKSSLNTQSFISAASFQETTRVLAKAAVEGKIDQLRGLKENVIIGNLIPAGTGTTTPKKPNSALRKVARVRLTSGFEVTAYIP Cyanidium ELVTINQIEYKPVLLGITKASLNTDSFISAASFQETTRILTEAAIEGKVDWLKGLKENVIIGRLIPGGTGTTTPKKPNSALRKVARVRLTSGFEITAYIP Odontella EVIDLYHIEYVPLLLGITKAALNNPSFISAASFQETTRVLTKAAIEGRVDWLRGLKENIIIGHLMPAGTGTTTPKKPNSAIRKVARVRLTSDLKVTAYIP Guillardia ELVELQQIEYCPILLGITKASLNTDSFISAASFQETTRVLTEAAIEGKADWLRGLKENVIIGRLIPAGTGTTTPKKPNSALRKVARVRLTSGFEVTAYIP Porphyra ELVELQKIEYRPILLGITQASLNTESFISAASFQETTKVLTEAAISGKLDWLRGLKENVIIGRLIPAGTGTTTPKKPNSALRKVARVRLTSGFEVTAYIP Arabidopsi GIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPEFITGSRKTSNFCWAFILFLGSLGFLLVGTSSYLGVISLFPQIIFF Nicotiana GIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPELITGSRKISNFCWAFILFLGSLGFLLVGTSSYLGLISFFPQIIFF Oryza GIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGALDAVAVKNRQQGRSKYGVKKPELLKGSRKRGNFFWACILFLGSLGFLAVGASSYLGIISVLPQILFF Pinus GIDHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAAEVKDRQQGRSKYGVKKQEPITGSRKRSNFFWACILFLGSLGFFLVGISSYFGLIPLLSQILFV Marchantia GIGHNLQEHSVVLVRGGRVKDLPGVRYHIIRGTLDAVGVKDRQQGRSKYGVKKSDFIIGSRRISNFCWAFILLFGALGFFFVGFSSYLQLIPFLSQILFI Nephroselm GIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDTAGVKERKQSRSKYGVKRVDIVIGSRRVSNYWWASVLLLGGSSFLVVGLSSRLGLVPFLPDIIFI Chlorella GIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDSAGVKDRSQSRSKYGVKRPYEVPGARRFGNYIWGSLMCLGGLGFLTIGISSYLDILSLVKNIQFF Chlamydomo GVGHNLQEHAVVLVRGGRVKDLPGVRYHIVRGSLDTAGVKNRVQSRSKYGVKMGYIIVGERRFSNYWWAIVIFLGSCGFLATGICSYLGWLSLLNIVPFF Mesostigma GIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGILDTAGVKDRAQSRSKYGVKRSESVVGSRRISNYWWASVVLLGASGFLIVGISSYLQLVPFLSNIVFV Cyanophora GIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDAAGVKDRRQSRSKYGAKRPDLITGSRRLSNYWWAITIGLGSSGFILAGISSYTKLLPFTDQFLFI Cyanidium GIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDSTGVKNRLRARSKYGASKPDKIVGAGKISNYLLLIIMLGGGISFFIVGFLSYFKHIALFSDIRFI Odontella GIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDSVGVKDRTQGRSKYGVKKPDDIIGSRRFSNYFWAVFLCSGGISFLLAGISSYFKFLPFANELAFI Guillardia GIGHNIQEHSVVLLRGGRVKDLPGVRYHIIRGTLDAAGVKNRKQSRSKYGAKKPDLILGSKRFSNYAWCFILMTGGIGFCLTGVGSYFNHTILFVDINFI Porphyra GVGHNIQEHSVVLIRGGRIKDLPGVRYHVVRGTLDAAGVKDRRKSRSKYGTKKPDVILGSRRFSNYWWASTIFIGALGFLLAGLSSYFQLLPFANELVFI Arabidopsi PQGIVMSFYGIAGLFISCYLWCTILWNVGSGYDLFDRKEGIVRIFRWGFPGKSRRIFLRFFMKDIQSIRIEVKEGVSARRVLYMEIRGQGAIPTDENFTT Nicotiana PQGLVMSFYGIAGLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRFLIKDIQSVRIEVKEGISARRVLYMDIRGQGSIPTDENLTP Oryza PQGVVMSFYGIAGLFISAYLWCTILWNVGSGYDRFDRKEGVVCIFRWGFPGIKRRVFLRFLMRDIQSIRIQVKEGLFPRRILYMEIRGQGAIPTDEKFTP Pinus PQGIVMCFYGIAGLFISSYLWCTILFNVGSGYNKFDKKKGIVCLFRWGFPGINRRIFPRFLMKDIQMIKMEIQEGISPRRVLYMEIKGRQDIPTGDNVNL Marchantia PQGIVMCFYGIAGLFISFYLWCTICWNVGSGYNKFDKQKGIFSIFRWGFPGKNRRIFIQFLIKDIQSIRMEVQEGFLSRRVLYIKIKGQPDIPIEEYFTL Nephroselm PQGLVMCFYGLVGLVVSTYLWLTILWSVGGGYNEFNKQEGVMRIFRWGFPGRDRRIQLTCPLQDIEAIRVELQEGMNPRRTIYVRLKGKREVPIGQPLTL Chlorella PQGLVMCFYGVLGFLLGVYIWLLILWNLGEGFNEFNLETGYVRIFRWGFPGKNRRIDLQYPIQEIQSIRVEIQEGINPKRIIYLKLRGNREIPAGQPLSI Chlamydomo PQGLLMSFYGSLGFLLSIYWSLLIFWNVGGGFNEFNKKEGFVRIFRWGYPGKNRKIDLSYSLKDIEAIRVELKQGLDAQRTIYLRLKGKREIPIGQPLTL Mesostigma PQGLVMCFYGSAGILLSIYLWLTIFWNVGEGYNEFDKVNGLVRIFRWGYPGKDRRINIVYDIKDIQAIRVEIKEGINPRRVIYLKIKGTRDMPIGQPLTL Cyanophora PQGITMLLYGTIGFLLDIYLWLLILWNVGAGYNEYNKKKGTVSIFRWGFPGTNRRIEVIYPIEQIQAIKLEIKQGLNPRHSISLKIQEKNEIVIGYLLPI Cyanidium PQGITMIFYGTMAICLSIYIYFSIYYDIGAGYNEFNLISKKVVVFRKGFPGKNRLIKFVLPIPHLKSVKVMARGGINPKYEVFLYTKNLSRIPIGQVFKL Odontella PQGLVMSFYGTLSIALAIYILGTLFWDIGSGYNEYNKVENLVKIVRKGFPGKNREILLTYPLTNIRAIGIKISEGLNPKRSIYLCLKDERQIPVQQPNSI Guillardia PQGIVMMFYGTIAILFSLFLMYSIFTDVGGGYNKYDKEKKEIEIFRLGYNKKNKQMLLKYNFRDIKSIKIELKDDINPKREIYLVTKNKNQIPIGEPLLL Porphyra PQGIVMTFYGSVGIFLSMFLWLTIIWNIGAGYNEFNKNEGIVKIFRLGFPGKNRQICLKFNIKEIKSIKIDIKEGLNPRREIYLCTKDKRNIPVGQPLLL Arabidopsi REIEQKAAELAYFLRVPIEVAFQLAVFALIITSSILLISVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIIQFEGFYRFIDQGLIEELAKFP Nicotiana REIEQKAAELAYFLRVPIEVAFQLAVFALIATSLILLISVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIIQFEGFCRFIDQGLTEELYKFP Oryza REIEQKAAELAYFLRIPMEVAFQLAVFALIVTSSVLVISVPLVFASPDGWSNNKNVVFSGTSLWIGLVFLVAILNSLIIQFEGFCRFINQGLAEELEKFP Pinus REIEQKAAESARFLRVSIEGAFQSAVFALIAISFLLVIGVPVALASPDGWSSSKNVVFSGVSLWIGSVLFVGILNSFIIQFEGFCRFIDQGLMEELHNFP Marchantia REMEDKAAELARFLKVSIEGAFQLAVFALIAISFLLVIGVPVVLASPEGWSSNKNVVFSGASLWIGLVFLVGILNSFIIQFEGFNRFINQGLSEELSNFP Nephroselm AEIEKQAAELAGFLQVSLEGIFQLALFALVALSFLLVVGVPVAFAAPEGWNVTKGYVFQGVSAWFALVFTVGVLNSLVIQRDSFLLFLERGLATELSHVT Chlorella QQIETQAAELAKFLQVSLEGIFQLALFAFIVVSFLLVVGVPVVLATPEGWAENKSTVFSGIGIWFLLVFLVGILNSFVVQRQSFYSFIEYGLKEAFQKPL Chlamydomo KEIEKQASELANFLQVSLEAILQVALLALIFVSFALVVGVPVVFATPNGWTDNKGAVFSGLSLWLLLVFVVGILNSFVIQRNSFFTLLEKGIIEEFSKRN Mesostigma AEIEEQAARLARFLQVNIEGAFQLTVLALIATSFLMVIGVPVIFASPEGWVKSKNFVFSGALLWISLVFAVGILNSFVMQLSSFRIFLKKGLIEELKDFS Cyanophora SVVEEQAANLASFLNIPLDSAFQGAVFALVLLSFVLIVAVPVALASPGEWERSQRLIYAGAALWTSLIIVIGVLDSVVIQKASFKWFFEEGLIEEIENFS Cyanidium SKLEYQASEIATFLGLAFEQLLQFFIISIIFFSLILVILVPSQLSLQSGWQVSKSRFIALFTIWASMILISGFISVFVVQRESFYSFLTEGLAKELNNFS Odontella SNLEEEAAELAKFLDLKLENMITALVALLVFISLGLVITVPVALATPGEWEASKSTFTRAFQAWVGLVIVIAAADGISMQRVSFCWFIAQGLNDELTMFS Guillardia SDVENQAIELANFLNIPIEGILQLLVSILILLSFALVVGVPVILVSPGEWERSKNLVYASAGLWFGLVIVTAAFNSFVIQRASFCWFLNEGLAEEIQSFS Porphyra SEVEEQAAEIARFLDVVLEGAIQLLVLLLITLSTILVVGVPVVLASPGQWEQSKGLIYTGAGLWTGLVIVTSLVNSLVIQRDSFKWFLLEGLTEVLEFFP Arabidopsi KIEDIEIEFQLFVETYQLVEPLIKERDAVYESLTYSSELYVSAGLIWKRIFIGNIPLMNSLGTSIVNGIYRIVINQILQSPGIYYQSELDHNGIWGGRLE Nicotiana KIEDTEIEFQLFVETYQLVEPLIKERDAVYESLTYSSELYVSAGLIWKTIFIGNIPLMNSLGTSIVNGIYRIVINQILQSPGIYYRSELDHNGIWGGRSE Oryza TIKDPEISFQLFAKGYQLLEPSIKERDAVYESLTYSSELYVSARLIFGTISIGNIPIMNSLGTFIINGIYRIVINQILLSPGIYYRSELDHKGIWGGRSE Pinus KIEDIEIEFRLFGNEYELAEPFIKERDAVYQSLTYYSELYVPARSIRRTVFLGNIPLMNSHGTFVVNGIYRVVVNQILISPGIYYRSELDHNRIWGRRSK Marchantia IIEDIEFEFQIFGEQYKLAEPLLKERDAVYQSITYSSDVYVPAQLTQKIVFLGSIPLMNSQGTFVVNGVARVIINQILRSPGIYYNSELDHNGIWGGRLK Nephroselm PLTGSHFRITLCSHGYRLKRPKVSIQEAVYQATSYSAALYVNVETNQSSVWMGDIPLMTSRGHFIINGSSRVVVNQIVRSPGIYFKEMIDQKHRRGSWVR Chlorella RFSTTDLEIRFFPEGIQFRKPDFTQKQAVVLGKIYGSAVYIPVGIHSKWLFVGILPIMTRQGHFVVNGVSRVVLHQMVRNPGIYTLPIHPRTKIKGGWIH Chlamydomo PITNSTMEIFFYPDYYQLTPPEYSPSQAIIKSKSYTSKLYIPVQLTDKWVYIGDIPLMTKRGHFILNGCARVIVNQMVRSPGIYYQKKIYENFSRGTWLR Mesostigma VISNSNLELRFFPEKYKLKRPKYNERTSIRRASTYTCQLYVPAKLTNKDVFLGEIPLMTGRGSFIINGSSRVIVNQIVRSPGIYYKREIDKKGRRGAWLR Cyanophora PVIDLNFEVHFYLKNYELEAPTFTLEEAKQRDLTYAAQLYIPVELRDLRIFFGEIPLMTDRCTFLINGVERVIINQIIRSPGIYYSVNTDEQGTRGAWLK Cyanidium PIIDYKLELHLVTNQLVIKKPKFSFEEAKRRDCSYTISINIVTQLFNKEILLGEIPLMTQKGTFVINGAERVIVNQIVRSPGIYFNSEMDKNNLRGAWLK Odontella RIHDFNTEYRLFGQEYSLVKPVYTIVRAKKLAANYSVQLVIPLEVRNKQFTIINLPLMTTTATFVINGCERVIVSQIIRSPGIYFEKNKNHRKRKLGYSK Guillardia PIVNYNLELHLFGDQYTLRYPKHNINECKRRDTTYSVQIYVPAQLINREVFIGDLPLMTDRGTFIINGAERVIVNQIVRSPGIYYKSELDKQGRRGAWVK Porphyra NISDPRLELQLFGKEYKIKFPRYSVRQAKSRDRTYSAQIYVPAKLTRKLVFIGDLPIMTNRGTFIVSGTERVIINQIIRSPGIYYKQDIDKNGKRGSWLK Arabidopsi LEIDKIWARVSRKQKISILVLSSAMGLEILSKENAFFHQRCELGRIGRRNINWRLNLNIPQNNIFLLPRDVLAAADHLIGMKFGMGTLDDMNHLKNKRIR Nicotiana LEIDRIWARVSRKQKISILVLSSAMGLEILSKENAFFQQRCELGRIGRRNMNRRLNLDIPQNNTFLLPRDILAAADHLIGLKFGMGALDDMNHLKNKRIR Oryza LAIDKIWARVSRKQKISILVLSSAMGSEILSKEKAFFQQKCELGRIGRRNMNRRLNLDIPQNSTFLLPRDVLAATDHLIGMKFETGILDDMNHLKNKRIR Pinus LEIDVIWARVSRKQKISIPVLLSAMGLEILSREKAFFRKRCELGKIGRRNLNQKLNLDIPENEIFSLPQDVLAAVDYLIGVKFGMGTLDDIDHLRNRRIR Marchantia LEIDGIWARISKKRKVSILVLLLAMGLNILSTEDAFFQQRCELGKIGRLNLNKKLNLNVPENEIFVLPQDILAAVDYLIKLKFGIGTIDDIDHLKNRRVC Nephroselm LETDVIWVRMDKAKKISILIVLEAMGLTIFSTTDALMDAKYDVGLVGRVKLNKKLKLPVPEHVHTLRPVDFLAATDYLIGLEYGRGQVDDIDHLKNRRVR Chlorella ITVDKVWFLTRSLRKVSLLIFLQAVGIDIFTQEEALWNKDLILGHIGRQQFREKIGSIEPLENTSLTREDLLEATQALLSLMHKKRVVDEIDSLTQKRIR Chlamydomo IEMDKIWAQMKRVPKIPIMWFLIAVGLIVLSKSQTFMNPRYDLGKVGRVNFNRKLKLSISQDITTLTPQDLLAATNNLILVSKGLRELDDIDHLKNRRVR Mesostigma IETDKIWARIGKIRKVSIMIVFKAMGLEIFPYLENFFQSKYDLGKVGRYKINKKLQLNIPENIRVLTVQDILAAVDYLINLEFNIGTLDDIDHLKNRRVR Cyanophora FEVDKIWMRIDKTHRLPCHIFLKALNLEILTEEEAFFDPKYDLGFVGRYKLNKKLNLNVSPNIRILTTQDILEILNYLINLQFGMGQIDDIDHLGNRRVK Cyanidium CEIDKIWIRIDKNKKINLSIFFKALGIDLRTQQEAFFNPKYDLGIVGRKKINKKLDLNSPENIRILTIQDILSGINYLINLKFGFGNIDDIDHLANRRLK Odontella YNSNKIYQKISKITVQRIKLFLQWLKLFIFTKEKKIFDARYRLGKIGRFQINNRLNLKLNNRIYTITYEDIFAILDCLVTLSISKTTGDDIDHLKNRRVR Guillardia FETDRVWVRIDKTRKIPAHVFLKAMGLDIYTTETAFFDPKYDLGKVGRYKLNKKLNLSVPENVRVLTPQDTLAAIDYLINLKFEIGETDDIDHLGNRRVR Porphyra FEIDPIWIRIDKTHKVNAYIFLRAIGLEIQTDEEAFFDPKYDLGEVGRYKINKKLGLNIPKTFRVLSPQDILSSIDYLINIKDKSGNLDDIDHLGNRRVR Arabidopsi SVADLLQDQLGLALARLENVVKGTISGAIRHKPTLTTTYESFFGLHPLSQVLDRTNPLTQIVHGRKLSYLGPGGLTGRTANFRIRDIHPSHYGRICPIDT Nicotiana SVADLLQDQFGLALVRLENVVRGTICGAIRHKPTLTTTYESFFGLHPLSQVLDRTNPLTQIVHGRKLSYLGPGGLTGRTASFRIRDIHPSHYGRICPIDT Oryza SVADLLQDQFGLALGRLQHAVQKTIRRVFIRQPTLITTYETFFGTYPLSQVFDQTNPLTQTVHGRKVSCLGPGGLTGRTASFRSRDIHPSHYGRICPIDT Pinus SVADLLQNQFRLALGRLEDAVKRTIRRATKRRSTLKNTFQDFFGSHPLSQFLDQTNPLTEIAHGRKLSHLGPGGLTGRTASFRTRDIHPSYYGRICPIDT Marchantia SVADLLQDQLKLALNRLENSVLFFFRGATKRKPTLIMTFKEFFGSHPLSQFLDQTNPLTEIVHKRRLSSLGPGGLTRRTASFQVRDIHASHYGRICPIET Nephroselm CAGELIQSQLRIGLNRLERTMQGRISRPGELPSSVMAALREFFGSNPLSQFMDQTNPLAELTHKRRLSSLGPGGLSQDRAGMAVREIHPSQYGRICPIET Chlorella GCDEFLLEHLATGMKEFELFFRRKVTFLPATKTGVSKSWKRFFTSGTLGQFMDQTNSLAETTHKRRLTVLGPGGISGKQTTIQIRGIHPTYYGRLCPIET Chlamydomo TSGELIQIQIGVGLVRLEKTIREKMTYASGLSPSFNGALREFFGTSPLSQFMDQINPLAELTHKRRLSSMGPGGVTRDSATLAIRGIHPSHYGRICPVET Mesostigma SVGELIQNQVRVGLGRLERMIYKRMGESSPDSLTLVGAIREFFGSSQLSQFMDQTNPLSEITHKRRLSCLGPGGLSRERAGLAVRDIHPSHYGRICPIET Cyanophora AVGELLQSQLRIGLNRLERLIHDRLSMLTTKSKRINECLKEFFGSSQLSQFMDQTNPLAELIHKRRLTILGPGGLSRDRAGCAVRDIHPSHYGRICPIET Cyanidium SVGELLQSQISIGLIRLERLIKERMTICEQSSPSIFAAIKEFFNSSQLSQFMDQVNPLAELTHKRRVSSLGPGGLSKERAGFAVRDIHPSHYGRICPIET Odontella SVGELLQNLFRVGFQRLVRKLGSQINKRESGQSFIGATVREFFGSSQLSQYMDQTNPLSSLTHRRRISGLGPGGLDRDRISFAVRDIHPSHYGRICPIET Guillardia SVGELLQNQVRIGLNRLERIIRERMTICDITSPNIIASIREFFGSSQLSQFMDQTNPLAELTHKRRISALGPGGLNRDRAGFGVRDIHPSHYGRICPIET Porphyra SVGELLQNQFRVGLNRLERIIRERMMICDIDSLSLIASVREFFGSSQLSQFMDQTNPVAELTHKRRISALGPGGFNKDRAGFAVRDLHPSHYGRICPIET Arabidopsi SEGINVGLIGSLSIHARIGSLESPFYELFLSPSQDEYYMIAAGNPARYRQEFLTIAWEEVHLRSIFPFQYFSIGASLIPFIEHNDANRALMSSNMQRQAV Nicotiana SEGINVGLIGSLAIHARIGSLESPFYEIYLSPGRDEYYMVAAGNPARYRQEFLTIAWEQVHLRSIFPFQYFSIGASLIPFIEHNDANRALMSSNMQRQAV Oryza SEGINVGLTGSLAIHARIGSVESPFYEIYLSPNRDEYYMIAAGNPARYRQEFLTIAWEQIHVRSIFPFQYFSIGGSLIPFIEHNDANRALMSSNMQRQAV Pinus SEGMNAGLVASLSIHAKIGSLQSPFYKIYLLPGEDEYYRIATGNPARYRQEFIVIAWEQIHFRSIFPFQYFSVGVSLIPFLEHNDANRALMGSNMQRQAV Marchantia SEGMNAGLIASLAIHAKIGCLESPFYKINLSAAEDEYYRIATGNPARYRQDFVAIAWEQVHLRSIFPLQYFSVGASLIPFLEHNDANRALMGSNMQRQAV Nephroselm PEGPNAGLIGSMATYARLGGLECPFYQVFLTAEQEDQVTVVAGDILRSRQEFHTGSFRDVNYVGIAPTQMISVATSLIPFLEHDDANRALMGSNMQRQAV Chlorella PEGKNAGLVNSFTVLSVLRTLTTPFYQVRVSPRQEYKLIEAPADPVRKELNFHSDVATRITTQSVGILQNISVATSLIPFLEHNDANRALMGSNMQRQAV Chlamydomo PEGKNTGLVNSLTAYARVGYIETPFYRVFFSAKQEEKIKLGAPDPVRIVEDFTKISRNEIQYVGVAPIQMISIATSLIPFFEHDDANRALMGSNMQRQAV Mesostigma PEGPNAGLIGSLATHSRVGFLESPFYITYLAPDQEDQFKVAPGDPVRYKQEFTTSKAEEVDYVGISPTQAISIATSLIPFLEHDDANRALMGSNMQRQAV Cyanophora PEGQNAGLVGSLTTHAHLGFIETPFYKVYLTADEEDQYRIAAADSVRYRQEFITTKIDQIDFIAISPLQTFSVSTSLIPFLEHDDANRALMGSNMQRQAV Cyanidium PEGPNAGLIGSLAIYARIGFIEAPFYKVYLDAEQEDEFKIAPGDPVRYRQEFTQCPAEEIDFIAVSPIQVISAATSLIPFLEHNDANRALMGSNMQRQAV Odontella PEGPNVGLIASLTTCARVGFIETPFWRVYLTADIEDFYKIAPADPVRYKQDFITVSPFQVDFISISPIQVVSVATSLIPFFEHDDANRALMGSNMQRQSV Guillardia PEGPNAGLIGVLATHARIGFIEAPFFKVYLTADQEDKYRIAPGDPIKYRQEFTTTKPNQVDFIAVSPIQVISIATSLIPFLEHDDANRALMGSNMQRQAV Porphyra PEGPNAGLIGSLATCARVGFIETPFYPVYLTADEEDDFRVAPGDPVRYRQEFVTTIPNQVDYIAISPIQVISAATSLIPFLEHDDANRALMGSNMQRQAV Arabidopsi PLSRSEKCIVGTGLERQVALDSGVPAIAEHEGKILYTDTEKIVFYQRSNKNTCMHQKPQVRRGKCIKKGQILADGAATVGGELALGKNILVAYMPWEGYN Nicotiana PLSRSEKCIVGTGLERQAALDSGALAIAEREGRVVYTNTDKILLYQRSNKNTCMHQKLQVPRGKCIKKGQILADGAATVGGELALGKNVLVAYMPWEGYN Oryza PLSRSEKCIVGTGLERQTALDSRVSVIAEREGKIISTNSHKILLHRRSNKNTCMHQKPRVPRGKSIKKGQILAEGAATVGGELALGKNVLVAYMPWEGYN Pinus PLFRPEKCIAGTGLEGQAALDSGSVAIATQEGRIEYIDAVNITSYQRSNTNTCTHQKPQIHQGECVKKGQILADGATTVGGELSLGKNVLVAYMPWEGYN Marchantia PLLKPEKCIVGTGIESQTALDSGSVTVSSHGGKIEYLDGNQIILYQRSNNSTCMHQKPKVEKQKYIKKGQILADGAATANGELALGKNILVAYMPWEGYN Nephroselm PLLKTEAPIIGTGLEAQVAADAGGVVQSPFEGIVVYVDATRIVVYQRSNQGTCIHQRPIIPLHTPVIRGDLLADGSSTSGGQIALGKNLLVAYMPWEGYN Chlorella PLLKPQAPLVGTGLESRVIGDVNHSMQASKTGFITKVSSTKIQVYQRTNQSTCFSERPILPENEWVEKGDLLADGASSSQGKLSIGQNVLVAYLPWEGYN Chlamydomo PILKPQRPIVGTGLEARAVSDSGHVITAKSSGIVMYTSSKEIIIYHRSNQDTCLIHKPAVKEGDWVEVGDLLADSASSIGGELAIGHNIIVAYMPWEGYN Mesostigma PLLKPNRPIVGTGFEEQVALDSGTVVICRHKGIVISVDSKTILVYNRSNQDTCINQKPVVSQGEWVQKGDILADGSATVNGELTLGQNILVAYMPWEGYN Cyanophora PLLHAEKPLVGTGLEFQVAKDSRRVLINKSEGLVKRVTGDHICIYQRSNQDTCITQRPIVFEGERVKKGQILADDTATDKGELALGQNLLVAYMPWEGYN Cyanidium PLIFPERPLVGTGLEAQIAKDSGIMAISRSNGIVKFTSAEKIIVYQKSNQETCINHRPIVWPGERIKKGQILADGSATDTGELALGRDVLVAYMPWEGYN Odontella PLMLSQKPIVGTGLENQIAIDSGMTINAQGAGIVHSVTADYIIVYQRSNQETCINHRPIVWKGEKIKSGQILTDGPGITNNELALGQNVLVAYMPWQGYN Guillardia PLLYPESPLVGTGLEAQAARDSGMVVVSIEDGQVTFVSGDKICVYQRSNQDTCINQRPTVWLGEDVIEGQVIADGAATEGGELALGQNILVAYLPWEGYN Porphyra PLLYPEKPIIGTGLETKIARDSGMVVISRTSGCVNYVSANKIGIYYRSNQDTCINQRPIVWVGEKIVVGQTLADGASTDCGEIALGRNILVAYMPWEGYN Arabidopsi FEDAVLISECLVYGDIYTSFHIRKYEIQTHVTTQGPERITKEILDKNGIVMLGSWVETGDILVGKLTPPEDRLLRAILGIQVSTSKETCLKLPIGGRGRV Nicotiana SEDAVLISERLVYEDIYTSFHIRKYEIQTHVTSQGPEKVTNEILDKNGIVMLGSWVETGDILVGKLTPPEDRLLRAILGIQVSTSKETCLKLPIGGRGRV Oryza FEDAVLISERLVYEDIYTSFHIRKYEIQTDTTSQGAEKITKEILDRNGVVKLGSWVETGDILVGKLTPAEAGLLRAIFGLEVSTSKETSLKLPIGGRGRV Pinus FEDAILISERLVYEDIYTSFHIVRYRIEICMTSQGPERITREILDENGLVMLGSWIETGDVLVGKLTPPEGRLLQTIFGIEVSTARENCLRAPIGGRGRV Marchantia FEDAILINERLIYEDIYTSIHIERYEIEARVTSQGPEKFTNEILDQNGIVLTGSWVETGDVLVGKLTPPEGKLLQAIFGIQVATSKETCLKVPPGGRGRV Nephroselm FEDAILISERLIYDDLYTSLHIERYEVETQHTKLGPEEITKSILDERGIVMRGAWVEPGDVLIGKITPPELRLVYAIFGKRPKGFRDTSLRVPQGVRGRV Chlorella FEDAILISQRLVDQEIFTSLHMDHYDIAVQNTQYGLERITNLILDSRGLVEIGSWVEPGDYLVGKMSPPHEKLYNVILQREKTSFRNTSLRVPKGVQGFV Chlamydomo YEDAILINERLVYEDIYTSIHIERYEVTTKETKLGFEQITREILDKTGIAKIGSWVEEGDILVGKITPPQQKLLYKIFDKQLSTTKDSSLRAPKGIKANV Mesostigma FEDAILISEKLVYEDIYTSIHIEKYEVDARKTKLGPEKITREILDDNGIVIPGARVESGDILVGKVTPPEGKLLRAIFGEKARDVRDSSLRVPNGVSGTV Cyanophora YEDAILINERLVYEDVYTSIHIEKYETETRQTKLGIEEITREILDEKGIVSVGSWIKGGDILVGKVAPPEGKLLKAIFGEKNRDVRDTSLRMPSGEKGRI Cyanidium YEDAFLISDRLVYEDLYTSIHIEKYEIEARQTKLGPEEITRNILDENGIVVVSSFVESGSILVGKVTPPESKLLQAIFGEKNKDVKDTSLRLPNGTRGRV Odontella FEDAILINERLVYEDVFTSIHIERYDIEIEQDDDVSEQITKNILNDDGIVALGTFVKPGDILVGKIIAPEAKLLRAIFGAKAKGVRDTSFRMPKGKYGRV Guillardia YEDAFLINERLVYNDVYTSVHIEKYEIEARQTKLGSEEITRELLDENGIIVIGSWVEAGDILIGKVTPPEGKLLRAIFGEKARDVRDTSLRVPNGGRGRI Porphyra YEDAFLISERLVYEDVYTSIHIEKYEVECRQTKLGPEEITREILDRNGIVVCGSWVEAGDILVGKITPPEGKLLRAIFGEKARDVRDTSLRLPNAAKGRV Arabidopsi IDVRWVQKIRVYISQKREIKVGDKVAGRHGNKGIISKILPRQDMPYLQDGRPVDMVFNPLGVPSRMNVGQIFECSLGLAGSLLDRHYRIAPFDERYEQEA Nicotiana IDVRWIQKIRVYILQKREIKVGDKVAGRHGNKGIISKILPRQDMPYLQDGRSVDMVFNPLGVPSRMNVGQIFECSLGLAGSLLDRHYRIAPFDERYEQEA Oryza IDVKWIQRVRVYILQKREIKVGDKVAGRHGNKGIISKILPRQDMPYLQDGTPVDMVFNPLGVPSRMNVGQIFESSLGLAGDLLKKHYRIAPFDERYEQEA Pinus IDVRWINRVHVYISQKRKIQVGDKVSGRHGNKGIISIVLPRQDMPYLQNGIPVDMVLNPLGVPSRMNVGQIFECLPGLAGNPMNKHYRITPFDEKYEREA Marchantia IDIRLISQIHIYILQKRKIQIGDKVAGRHGNKGIISKILPRQDMPFLQDGTPIDMILSPLGVPSRMNVGQIFECLLGLAGSFLHKNYRIIPFDERYEREA Nephroselm VDVRMIRDVHVYVCQQRQIQVGDKMAGRHGNKGIVSRIVPRQDMPYLQDGTPVDMVLNPLGVPSRMNVGQVFECLLGLAGQRLGQQLKVRAFDEMYGAEA Chlorella LGVQILPSVRVLLLQRRKIQVGDKMAGRHGNKGIVSLILPRQDMPYLPDGTPVDIVLNPLGVPSRMNVGQILECLLGLAGHFLHERYTTYLFDEQYGAEA Chlamydomo ININILARIHIYLAEKRKMQVGDKMAGRHGNKGIVSRILPRQDMPFLPDGAAVDIVLNPLGVPSRMNVGQIYECLLGLAGRYLGEHYKIPPFDEMYGADA Mesostigma VNVRRLTGVHVSISQKRKIQVGDKMAGRHGNKGIISKILPRQDMPYLQDGTPVDMVLNPLGVPSRMNVGQVFECLLGLAGEYLSENYKLMPFDEMYGKET Cyanophora VDVRIFIRVRIYIAQKRKIQVGDKMAGRHGNKGIISKILPRQDMPYLPDGTPIDIILNPLGVPSRMNVGQVYECLLGWAAEHLGVRFKLIPFDERFGKQA Cyanidium VDVRIFSRVRIYVAQKRKIQIGDKMAGRHGNKGIISKILPRQDMPYLPNGTPVDIILNPLGVPSRMNVGQIFECILGISAFNLKKRFRILPFDEMYESDS Odontella VDRVTFNRIQVFIAQIRKIKVGDKIAGRHGNKGIISRILPRQDMPFLPDGTPVDIILNPLGVPSRMNVGQLYECLLGIAGHKLNRRFKILPFDEMYGPEV Guillardia LDVRIFTRIRVYIAQSRKIQVGDKMAGRHGNKGIISRILPRQDMPYLPDGTPVDLVLNPLGVPSRMNVGQIFECLLGLAAENLNKRFKITPFDEMHGAEA Porphyra VNVRVFTRIRVYVAQKRKIQVGDKMAGRHGNKGIISRILPKQDMPYLCDGTPVDIVLNPLGVPSRMNVGQVFECLLGLAGGYLDKRFKIIPFDEMYGAEA Arabidopsi SRKLVFSELYEASKQTANPWVFEPEYPGKSRIFDGRTGDPFEQPVIIGKPYILKLIHQVDDKIHGRSSGHYALVTQQPLRGRSKQGGQRVGEMEVWALEG Nicotiana SRKLVFSELYEASKQTANPWVFEPEYPGKSRIFDGRTGNPFEQPVIIGKPYILKLIHQVDDKIHGRSSGHYALVTQQPLRGRAKQGGQRVGEMEVWALEG Oryza SRKLVFSELYEASKQTKNPWVFEPEYPGKSRIFDGRTGDPFEQPVLIGKSYILKLIHQVDEKIHGRSTGPYSLVTQQPVRGRAKQGGQRIGEMEVWALEG Pinus SRKLVFPELYKASEQTANPWVFEPDHPGKHRLIDGRTGDVFEQPVTIGKAYMSKLSHQVDEKIHARSSGPYARVTQQPLRGKSKRGGQRIGEMEVWALEG Marchantia SRKLVFSELYKASKKTTNPWLFEPDNPGKNRLIDGRTGEIFEQPITIGKAYMLKLIHQVDDKIHARSSGPYALVTQQPLRGRSRRGGQRVGEMEVWALEG Nephroselm SRHLVYNKLHEASEVTGHHWLFDPNHPGKSRLIDGRTGDMFDQAVTIGQAYMLKLIHQVDDKIHARATGPYSLITQQPLGGRSKRGGQRLGEMEVWAFEG Chlorella SRSLVYSKLYQASLKTRNPWVFEPHHPGKIRVFDGRTGLTFDQPITAGYAYILKLVHLVDDKIHARPTGPYSAITQQPVKGRARNGGQRLGEMEVWALQA Chlamydomo SRSFVLSKLYEARKKTGLKWLLDPNHPGKIRLFDGRNSECFDQTVTVGIAYVLKLVHMVDDKMHARSTGPYSLVTQQPLRGRSKQGGQRLGEMEVWAIEG Mesostigma SRGLVYSKLYEARQKTGYPWLFNIQSPGKSKLFDGRTGESFDQPVTIGKAYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGRAKHGGQRLGEMEVWALEG Cyanophora SRTFIHEKLKEAKELTNKNWLFNSNHPGKIQLFDGRTGESFDNPIMVGKAYMLKLVHLVDDKIHARSTGPYSLITQQPLGGKAQQGGQRFGEMEVWALEA Cyanidium SRILINQKLKEAQTLTNLDYLFNENHLGKVALFDGRSGEKFDNPVLVGKIYMMKLVHLVDDKIHSRSTGPYSLVTQQPLGGKAQQGGQRLGEMEVWAFEA Odontella SRILINKKLRQASIENDEAWLFNPYSPGKMVLIDGRTGKEFENPITVGNAYMLKLIHLVDDKMHARATGPYSLITQQPLGGKAQHGGQRFGEMEVWALEG Guillardia SRVLVNEKLNEAKIKTGENWLFDLRHPGKITLYDGRTGEAFDNPVTIGVSYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGRAQHGGQRLGEMEVWALEA Porphyra SRALVNRKLQEASILTKNKWIFNDQHPGKMQVFDGRTGEPFDNPVTIGRAYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGRAQHGGQRLGEMEVWALEA Arabidopsi FGVAHILQEMLTYKSDHIRARQEVLGTTIIGGTIAPESFRLLVRELRSLALELNHF Nicotiana FGVAHILQEMLTYKSDHIRARQEVLGTTIIGGTIAPESFRLLVRELRSLALELNHF Oryza FGVAHILQEILTYKSDHLIARQEILNATIWGKRVPPESFRVLVRELRSLALELNHF Pinus FGVAYILQEMLTLKSDHIRTRNEVLGAIITGGPIAPESFRLLIRELRSLALELNHA Marchantia FGVAYILQEMLTIKSDHIRARYEVLGAIVTGEPIAPESFKLLVRELRSLALEINHV Nephroselm FGAAYTLQELLTVKSDDMQGRNEIMSAMVQGRQLTPESFKVMIRELQALCLDIGIY Chlorella YGAAHTLHEFFTVKSDDLDGRQQAVLNIYANKPVNPESFKLILRELQALCFNFQVY Chlamydomo YGAAFVLSEMLTIKSDDMTGRQNLWKNLIENKEISPESFKVLICELQALCLDIGLF Mesostigma FGAAYTLQELLTIKSDDMKGRNDALNAIIKGRPITPESFKVLIRELQSLCLDIGVY Cyanophora FGAAYTLQEILTIKSDDMLGRNEALKAIVKGKAIIPESFKVLMRELQALCLDVVAY Cyanidium FGAAYALQELLTIKSDDIQGRNEALTAIVRGKTITPESLKVLMREIQSLGLDIAAY Odontella FGAAFTLKELLTIKSDDMQGRNETLNAIVKGQLIVPESFKVLLQELRSIGLDMSTY Guillardia FGASYTLQELLTVKSDDMQGRNETLNAIVKGKPITPESFKVLMRELQSLGLDIGAY Porphyra FGAAYTLQELLTVKSDDMQARNEALNAIVKGKPITPESFKVLMRELQSLGLDIAVH ; End;