Table 1.

Phosphate Transporter Motifs Generated by MEME

Motif No.WidthSequence
118GLPVSTTHCIVGAVIGVG
247TLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGFG
322CGTIPGYWFTAWLVDKLGRKKI
410GANDVANALG
538YSLTFFFANFGPNATTFIVPGEIFPARYRSTCHGISAA
620HGLHLLGTASSWFLLDIAFY
713YWRMKMPETPRYT