Table 2.

Motifs Present in the MtPT4 Sequence

Motif No.Percent IdentityAlignment
10Absent
295126TLCFFRFWLGFGIGGDYPLSATIMSEYANKRTRGAFIAAVFAMQGVG172 (MtPT4)
 TLCFFRFWLGFGIGGDYPLSATIMSEYANK1TRGAFIAAVFAMQG G
 TLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGFG (motif)
366350GTFPGYWFTVFFIEKLGRFKI370 (MtPT4)
 GT PGYWFT + ++KLGR KI
 GTIPGYWFTAWLVDKLGRKKI (motif)
40Absent
573404YGLTFFFANFGPNSTTFVLPAELFPTRVRSTCHAFSAA441 (MtPT4)
 Y LTFFFANFGPN+TTF++P E+FP R RSTCH SAA
 YSLTFFFANFGPNATTFIVPGEIFPARYRSTCHGISAA (motif)
680289HGRHLIGTMSCWFLLDIAFY308 (MtPT4)
 HG HL+GT S WFLLDIAFY
 HGLHLLGTASSWFLLDIAFY (motif)
70Absent
  • The identity and alignment are based on the BLAST algorithm. The positions of the motifs in the MtPT4 open reading frame are indicated at the beginning and end of the sequences.